KEGG   Vulpes vulpes (red fox): 112929273
Entry
112929273         CDS       T05911                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04610  Complement and coagulation cascades
vvp04810  Regulation of actin cytoskeleton
vvp05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112929273 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    112929273 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112929273 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:vvp04515]
    112929273 (ITGAX)
   04090 CD molecules [BR:vvp04090]
    112929273 (ITGAX)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112929273 (ITGAX)
CD molecules [BR:vvp04090]
 Proteins
  112929273 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 112929273
NCBI-ProteinID: XP_025867021
UniProt: A0A3Q7TNZ9
LinkDB
Position
Unknown
AA seq 1166 aa
MSNLLVMTRTRTSLLLLMALASSLCFNLDTEQPKSFLMESAGFGHSVVQYDNSWVVVGAP
QEIKAANQTGGLYQCDYSTGKCEPIQLQVPLEAVNMSLGLSLAASTKPSQLLACGPTVHH
TCNENIYLTGFCFLLGSPSWQAQRLPAALQECPKQEQDIVFLIDGSGSISSHDFIKMLNF
VKAVMSQFQRPSTQFSLMQFSNNFRVCFTFKDFTYSSNPIALLDSVSQLGGLTHTATAIR
IVTNELFSASKGARKDASKILIVITDGQKKGDSLGYEDVIPMAEAAGIIRYAVGVGTAFQ
KMQSWKELNDIASKPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFEMEMSQ
EGFSAVFTPDGPVLGAVGSFSWSGGAFLYPPKTSPTFINISQENVDMRDSYLGYSAELAF
WKGVQSLILGAPRHQHTGKVVIFTQASEQWRPKAEVSGTQIGSYFGASLCTVDVDRDGNT
DLVLIGAPNYYEPTQGGQVSVCPLPQGRAKWQCEVILRGEQGHPWGRFGAALTLLGDVNG
DKLTDVAIGAPGEQENRGAVYLFHGISGRSISSSHSQRISGSQLSPSLQYFGQSLSGGQD
LTMDGLVDLAVGAQRQVLLLRTRPVLRVWMSIQFKPTEIARSISECREKTSSVKALGDAN
VCLHIYESPKNRLGDLQSSVTFDLTLDPGRQSPRAIFEETKTRNLTRVQVLGLRQYCETV
KLLLLACVEDTVTPITLRLNFSLVGKPIPSFGSLRPMLAVDAQRYFTASLPFEKNCGTDH
VCQDDLGISFNFSGLQTLVVGSTLELNMNVMVWNDGEDSYGTTVTFFYPPGLSYRRVVES
KSQLQPHSPRLTCDGIPAQGQGTQSTRCSINHLILREGAQITFTVTFDVSPKAMLGDRLL
LTANVSSENNTPRTSKSTFQLELVVKYAVYTVISSHEQSTKYLNFSASDQEKSSQAHHRY
QVNNLGQRDLPISINFSVPVELNGMPVWTNLEIFHPQNPSIQCSLERTVHTESDFLTHIQ
KNSVVNCSIADCMRFHCDFPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFN
RSVYSQIPGQEAFLRAQVETVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKAGFFKR
QYKEMMAEANGQVAPENGTSDPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctaaccttctagtcatgaccaggaccagaacatccctccttctattgatggccttg
gcttcttctctctgcttcaacttggacacggaacagccaaaaagcttccttatggagagt
gctggatttggacacagcgtggtccagtatgacaactcctgggtggtagttggagccccc
caggagataaaggctgccaaccaaacaggtggcctctaccagtgtgactacagcaccggc
aagtgtgagcccatccaactgcaggtccccttggaagctgtgaacatgtccctgggcctg
tctctggcagcctccactaaaccctctcagctgctggcctgtggccccacagtgcaccat
acatgcaacgagaacatatacttgactgggttctgcttcctgctgggctccccttcctgg
caagcccagaggctcccagctgccctgcaggagtgtccgaagcaagagcaggatatcgtg
ttcctgatcgacggctctggcagcatctcctcccatgattttatcaagatgttgaatttc
gtgaaggctgtgatgagccagttccagagacctagcacccagttctccctgatgcagttt
tccaacaatttccgggtgtgcttcactttcaaagacttcacatacagctcaaacccgata
gccctgttggattctgtatcccagctaggagggctcactcacacagccacagccatcaga
atagtcacaaatgaactgttcagtgcctcaaaaggggcccgaaaagatgcctccaagatc
ctcattgtcattaccgatgggcagaaaaaaggagatagcctgggttatgaagatgttatc
cctatggctgaggctgcgggtatcatccgctatgcagttggggtaggaacagcttttcaa
aagatgcagtcctggaaagaattaaatgacattgcatcgaagccctcccatgagtacatt
tttaaagtggagaattttgatgctttgagagacattcaaaaccaactgaaagagaagatc
tttgccattgagggtacgcagaccataagcagtagttcctttgaaatggagatgtcccag
gagggcttcagcgctgtgttcacacctgatggaccagttctgggggctgtggggagcttc
agctggtctggaggtgccttcctgtaccctccaaagacgagccccactttcatcaacata
tctcaagagaatgtggacatgagggactcttacctgggttactccgctgagctggccttt
tggaagggagtacagagcctgatcctgggggccccccgccatcagcacaccgggaaggtt
gtcatcttcactcaggcatctgagcaatggaggccgaaggctgaagtctcagggacccag
attggctcctactttggggcctccctctgcacagtggatgtggatagagatggcaacact
gacctcgtcctcatcggggctcccaattactacgagccgacccaggggggccaggtgtct
gtgtgccccttgccccaggggagggcgaagtggcagtgtgaggtcattctccgtggagag
caaggccacccctggggccgttttggggcagccctgacactgctgggcgatgtgaatggg
gacaagctgacagacgtggccatcggagcgccaggagagcaggagaaccgaggtgctgtc
tacctatttcatggaatctcaggacggagcatcagctcctcccacagtcagaggatctca
ggctcccagctctcccccagcctccagtattttgggcagtcactgagtgggggtcaggac
cttaccatggatggactggtggacctggctgtgggcgcccagagacaagtgctgctgctc
aggaccagacctgtgctcagggtgtggatgagcatacaattcaaacctacagagatagcc
aggtctatatctgagtgtcgggaaaagacttcctctgtcaaggcactgggtgatgccaat
gtctgccttcatatttatgaaagtcccaagaatcggctgggtgacctccaaagctctgtg
acctttgaccttactcttgacccgggccgccagagtccccgtgccatctttgaggagaca
aagacccggaatctgactcgtgtgcaagtccttggcctgagacagtactgtgagaccgtg
aagttgctcctcctggcctgtgtggaggacacggtcacccccatcaccttgcgtctcaac
ttctccctggtgggcaagcctatcccttcctttggaagccttcggcctatgttggctgtg
gatgctcagagatacttcacagcctctctcccctttgagaagaattgtggaactgaccat
gtctgccaggatgaccttggcatttcctttaacttctcaggattgcagaccctggtggtg
gggagtaccctggagctgaacatgaacgtgatggtgtggaatgatggtgaggactcctat
ggaaccacagtcaccttcttctacccaccagggctgtcttatcgacgtgtggtagagagc
aagagccagctacagccacactccccacgcctgacctgtgatggcatcccagcccagggc
cagggtactcagagcacccgctgcagcatcaaccacctcatcctccgtgaaggtgcccag
atcaccttcacagtcacgtttgacgtctctcccaaggccatgctgggagaccggttgctt
ctgacagctaatgtgagcagtgaaaataacactcccaggaccagcaagagcacctttcag
ttggagctcgtggtgaagtatgccgtctacaccgtgatcagcagccacgaacagtccact
aagtacctcaacttctcagcctcagaccaggagaaaagcagccaggctcaccatagatac
caggtcaacaacctgggacagagggacctgcctatcagcatcaatttctctgtgcctgtg
gagctgaatgggatgcctgtgtggacgaacttagagatcttccacccccagaacccatcc
attcagtgctctttagagagaacagtgcacacagagtctgacttcctgacccacattcag
aagaattctgtggtgaactgctccattgctgactgcatgaggttccactgtgatttcccc
tcctttggcatccaggaggaacttgacttcattctgaagggcaacctcagctttggttgg
gtcagccagacattgcagaagaaggtattggtcgtgagtgtggctgaaatcacattcaac
agatctgtgtattcccagattccaggacaagaggcattcttgagagctcaggtggagacg
gtattggagaagtatgaggtctacaaccccatccccattattgttggaagctctgtggga
ggactgctgctgttggccctcatcacagccatcctatacaaggctggcttcttcaaacgt
cagtataaggaaatgatggcagaagcaaacggacaggttgccccagaaaatgggacatca
gatcctcaagttgcccaataa

DBGET integrated database retrieval system