KEGG   Vulpes vulpes (red fox): 112929695
Entry
112929695         CDS       T05911                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112929695 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:vvp04050]
    112929695 (TNFRSF8)
   04090 CD molecules [BR:vvp04090]
    112929695 (TNFRSF8)
Cytokine receptors [BR:vvp04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   112929695 (TNFRSF8)
CD molecules [BR:vvp04090]
 Proteins
  112929695 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 112929695
NCBI-ProteinID: XP_025867657
UniProt: A0A3Q7U2L8
LinkDB
Position
Unknown
AA seq 506 aa
MFCATSATNSCARCIFHSICATGMVVRFQGTAERDTVCELPAPATSPDCSTSPEACQAPT
RRIGGAISGFFPSSAPPQARPLLTSSASSRARTTLLGGGAPLTPEDDPKVARATASPSAQ
KPRPDLGLTAQQLCPQGSSDCGKQCEPDYYLDRDGRCKACVSCSGDDLVEKTPCTWNSSR
VCECRPGMFCATSATNSCARCITHPICPPGMVTKPQGTAERAAPHELPAPEAHPACSINP
DDSTAPTSTTASLVPTVDPQPSKERGGPITHAWGDPSISTSTPVSFSSTGKPVLVSGPVL
FWMVVILVVVLGSVSFVLCHRRACRKWIQQKLHLCYPVQTFRPKLEPADARSRRNLMQLE
KSISVVESGLEEVGLMSSPAVDPGPDGAACLESVRLLEASPASGPPSPRDLPEPRLTSEH
TNNRIEKIYIMKADTVIVGTVRTEGPEGRSLVGPAGPEFEEDLEVDHAPHFPEQETEPPL
GSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgttctgtgccacatcagccaccaatagctgtgcccgctgcatcttccactccatctgc
gcgacagggatggttgtcaggttccagggcacggcagagagggacactgtctgtgagctg
cctgccccagcgaccagccctgactgcagcaccagccccgaagcctgccaggcccccacc
aggagaattggcggtgccatttctggcttctttcccagcagcgcccccccgcaggccagg
cctctcctgacttcctcagcaagctccagggccaggaccacgcttcttggagggggtgct
cccctcaccccggaagatgatcccaaagtggcaagggccaccgcctctccctctgcgcag
aagccccgtccagacctagggctgaccgcgcagcagctgtgcccacaggggtcctccgac
tgcgggaagcagtgcgagcccgactactacctggaccgggacggccgctgcaaggcctgt
gtgagctgctctggagatgacctggtggagaagactccttgtacatggaactcctctcgc
gtctgtgaatgtcggcctggcatgttctgtgccacctcagccaccaactcctgtgctcgc
tgtatcacccaccccatctgcccaccagggatggtcaccaaaccccagggtacagctgag
agggctgctccccatgagctgcctgcccccgaggcccaccctgcgtgcagcatcaaccca
gacgacagcacggcgcccaccagcaccactgcctctctggtccccacggtagacccccag
cccagtaaggagcgtggggggcccatcacccacgcctggggagacccctccatatcaact
agcactcctgtctcgttctcctccaccgggaagcccgttctggtttcagggcccgtgctc
ttctggatggttgtgatcctggtggtggtcttgggctctgtctccttcgtcctgtgccac
cggagggcctgcaggaagtggattcagcagaagctgcacctgtgctaccctgtccagacc
ttccggcccaagctggagcctgcggatgccaggtccaggaggaacctgatgcagctggag
aagagtatatcggtggtcgagtcgggcctggaagaggtgggcttaatgagctccccggct
gtggaccccggccccgacggggcggcctgcctggagagcgtgcggctgctggaagccagc
ccggccagtggtcccccgtcccccagggaccttcccgagccccggctgacctcggagcac
accaacaacaggatcgagaagatctacatcatgaaggctgacaccgtgattgtggggacc
gtcaggaccgaggggcctgagggccgcagcctggtggggccggcagggcctgaattcgag
gaggatctggaagtggaccatgccccccacttcccggagcaggagacagaaccacctctg
ggcagctgtggggacgtcatgttctcagtagaagaggaaggaaaagaggcccccttgccc
atgaccgtctctgagaaatga

DBGET integrated database retrieval system