Vulpes vulpes (red fox): 112930936 Help Entry 112930936         CDS       T05911                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism vvp  Vulpes vulpes (red fox) Pathway vvp04014   Ras signaling pathway vvp04015   Rap1 signaling pathway vvp04020   Calcium signaling pathway vvp04022   cGMP-PKG signaling pathway vvp04024   cAMP signaling pathway vvp04070   Phosphatidylinositol signaling system vvp04114   Oocyte meiosis vvp04218   Cellular senescence vvp04261   Adrenergic signaling in cardiomyocytes vvp04270   Vascular smooth muscle contraction vvp04371   Apelin signaling pathway vvp04625   C-type lectin receptor signaling pathway vvp04713   Circadian entrainment vvp04720   Long-term potentiation vvp04722   Neurotrophin signaling pathway vvp04728   Dopaminergic synapse vvp04740   Olfactory transduction vvp04744   Phototransduction vvp04750   Inflammatory mediator regulation of TRP channels vvp04910   Insulin signaling pathway vvp04912   GnRH signaling pathway vvp04915   Estrogen signaling pathway vvp04916   Melanogenesis vvp04921   Oxytocin signaling pathway vvp04922   Glucagon signaling pathway vvp04924   Renin secretion vvp04925   Aldosterone synthesis and secretion vvp04970   Salivary secretion vvp04971   Gastric acid secretion vvp05010   Alzheimer disease vvp05012   Parkinson disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05031   Amphetamine addiction vvp05034   Alcoholism vvp05133   Pertussis vvp05152   Tuberculosis vvp05163   Human cytomegalovirus infection vvp05167   Kaposi sarcoma-associated herpesvirus infection vvp05170   Human immunodeficiency virus 1 infection vvp05200   Pathways in cancer vvp05214   Glioma vvp05417   Lipid and atherosclerosis vvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112930936 (CALML4)    04015 Rap1 signaling pathway     112930936 (CALML4)    04371 Apelin signaling pathway     112930936 (CALML4)    04020 Calcium signaling pathway     112930936 (CALML4)    04070 Phosphatidylinositol signaling system     112930936 (CALML4)    04024 cAMP signaling pathway     112930936 (CALML4)    04022 cGMP-PKG signaling pathway     112930936 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112930936 (CALML4)    04218 Cellular senescence     112930936 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112930936 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     112930936 (CALML4)    04922 Glucagon signaling pathway     112930936 (CALML4)    04912 GnRH signaling pathway     112930936 (CALML4)    04915 Estrogen signaling pathway     112930936 (CALML4)    04921 Oxytocin signaling pathway     112930936 (CALML4)    04916 Melanogenesis     112930936 (CALML4)    04924 Renin secretion     112930936 (CALML4)    04925 Aldosterone synthesis and secretion     112930936 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112930936 (CALML4)    04270 Vascular smooth muscle contraction     112930936 (CALML4)   09154 Digestive system    04970 Salivary secretion     112930936 (CALML4)    04971 Gastric acid secretion     112930936 (CALML4)   09156 Nervous system    04728 Dopaminergic synapse     112930936 (CALML4)    04720 Long-term potentiation     112930936 (CALML4)    04722 Neurotrophin signaling pathway     112930936 (CALML4)   09157 Sensory system    04744 Phototransduction     112930936 (CALML4)    04740 Olfactory transduction     112930936 (CALML4)    04750 Inflammatory mediator regulation of TRP channels     112930936 (CALML4)   09159 Environmental adaptation    04713 Circadian entrainment     112930936 (CALML4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112930936 (CALML4)   09162 Cancer: specific types    05214 Glioma     112930936 (CALML4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112930936 (CALML4)    05163 Human cytomegalovirus infection     112930936 (CALML4)    05167 Kaposi sarcoma-associated herpesvirus infection     112930936 (CALML4)   09171 Infectious disease: bacterial    05133 Pertussis     112930936 (CALML4)    05152 Tuberculosis     112930936 (CALML4)   09164 Neurodegenerative disease    05010 Alzheimer disease     112930936 (CALML4)    05012 Parkinson disease     112930936 (CALML4)    05022 Pathways of neurodegeneration - multiple diseases     112930936 (CALML4)   09165 Substance dependence    05031 Amphetamine addiction     112930936 (CALML4)    05034 Alcoholism     112930936 (CALML4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112930936 (CALML4)    05418 Fluid shear stress and atherosclerosis     112930936 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vvp01009]     112930936 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvp04131]     112930936 (CALML4)    03036 Chromosome and associated proteins [BR:vvp03036]     112930936 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112930936 (CALML4) Protein phosphatases and associated proteins [BR:vvp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112930936 (CALML4) Membrane trafficking [BR:vvp04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112930936 (CALML4) Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112930936 (CALML4) Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112930936 (CALML4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_9 SAPC2_N EF-hand_11 YuzC EF-hand_EFHB_C Motif Other DBs NCBI-GeneID:  112930936 NCBI-ProteinID:  XP_025869229 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MRCLGASPTPGEVQRHLQSHKIDRDGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKE KKGYIMASELRSKLMKLGEKLTHKEVDDLFKEANIEPNGKVKYDEFIHKITIPVWDH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaggtgcttgggggccagcccaacgccaggggaggtgcagcgccacctgcagagtcac aagatagacagagatggggagctggatttctccactttcctgaccattatgcacatgcaa ataaaacaagaggatccaaagaaagaaattctcttggccatgttgatggcagacaaggag aagaaaggctacatcatggcatccgagctgcggtccaaactcatgaaactaggggagaaa ctcacccacaaggaagtggatgatcttttcaaggaagcaaatatagaaccaaatggcaaa gtgaagtatgatgaatttatccacaagatcaccattcctgtgtgggaccactga

DBGET integrated database retrieval system