KEGG   Vibrio vulnificus CMCP6: VV1_0803
Entry
VV1_0803          CDS       T00108                                 
Name
(GenBank) N-Acetylneuraminate cytidylyltransferase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00541  O-Antigen nucleotide sugar biosynthesis
vvu01100  Metabolic pathways
vvu01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    VV1_0803
SSDB
Motif
Pfam: CTP_transf_3 IspD NTP_transf_3 UvrD_C_2 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: AAO09307
UniProt: A0A3Q0L2P3
LinkDB
Position
I:complement(811877..812578)
AA seq 233 aa
MKILAITPARGGSKRLPGKNIKNLNGKPLIQWTIDAALAVQEIARVMVTTDCDEIAEIAK
KAGAEVPFIRPPELATDTSSSSDVIRHALDFYRAQGEEFDFVLLLQPTSPIRSADDIRHA
IEQLIAHTADAVVSVCPCDHSPLWANTLPDDRSMADFIRHEVSQLRSQDLPDYYRINGAI
YLTRVSRFYQENSLFLSSNIFAYVMDNESSVDIDHELDFLIAETVLKYREQNA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaaaatactggcgattactcctgcccgcgggggcagcaagcggctaccaggcaagaac
atcaaaaatttaaatggtaagcctctaatccaatggacaatagatgccgccttagcggtg
caagagatcgctcgcgtcatggtgacgacggactgtgacgagattgcggagattgcgaaa
aaagcgggggcagaggtgccgtttatccgcccaccagagttagccaccgacaccagttcc
agttccgatgtgatccgtcatgcgctggatttttatcgcgcacaaggtgaagagtttgat
tttgtcttactgttacaacccacgtcaccaattcgcagtgcggatgacatccgccacgcg
atcgagcaacttatagcgcatacggcggatgccgtcgtgtcagtgtgcccttgtgatcac
tcgccactttgggctaataccttaccagacgatcgctcgatggccgattttatccgtcat
gaagttagccagttgagaagtcaggatcttcctgattactatcgaattaatggtgcaatc
tacttaacaagagtgagcagattctaccaagaaaactcgctattcttatcttcaaacata
tttgcctatgtaatggataatgaaagctcggttgatattgaccatgagttggattttctg
attgcagaaacggtattaaaatatagggaacaaaatgcataa

DBGET integrated database retrieval system