Wallemia mellicola: WALSEDRAFT_17645 Help Entry WALSEDRAFT_17645  CDS       T03142                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism wse  Wallemia mellicola Pathway wse03022   Basal transcription factors wse03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:wse00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     WALSEDRAFT_17645   09124 Replication and repair    03420 Nucleotide excision repair     WALSEDRAFT_17645  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:wse03021]     WALSEDRAFT_17645    03400 DNA repair and recombination proteins [BR:wse03400]     WALSEDRAFT_17645 Transcription machinery [BR:wse03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      WALSEDRAFT_17645 DNA repair and recombination proteins [BR:wse03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      WALSEDRAFT_17645 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 HTH_Tnp_Tc3_2_like Motif Other DBs NCBI-GeneID:  18470736 NCBI-ProteinID:  XP_006957743 JGI:  Walse1_17645 UniProt:  I4YDK6 LinkDB All DBs Position Unknown AA seq 55 aa AA seqDB search DPAVKQIILNLNDKSKFIVQDLDLQHILVSPDSVQSIKYELENEVCRTVHRTSAV NT seq 168 nt NT seq  +upstreamnt  +downstreamnt gatccagctgtcaagcagattatactcaatttgaacgataaatcaaagtttattgtccag gatttagatctccagcatatactagtcagcccagacagcgtacagtctataaagtacgaa ttggagaacgaggtgtgtagaacagtacacagaacatccgccgtctga

DBGET integrated database retrieval system