KEGG   Xanthobacter autotrophicus: Xaut_5021
Entry
Xaut_5021         CDS       T00581                                 

Name
(GenBank) methylmalonyl-CoA mutase, large subunit
  KO
K20906  2-hydroxyisobutanoyl-CoA mutase large subunit [EC:5.4.99.64]
Organism
xau  Xanthobacter autotrophicus
Brite
KEGG Orthology (KO) [BR:xau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Xaut_5021
Enzymes [BR:xau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     Xaut_5021
SSDB
Motif
Pfam: MM_CoA_mutase
Other DBs
NCBI-ProteinID: ABS70219
UniProt: A7IQC3
LinkDB
Position
pXAUT01:239450..241138
AA seq 562 aa
MSMSEIMTLANLDDDVRHWEETEVAAFLKKQKERKEQFFTLGDFPVKRVYTAADAAATPI
EDIGLPGRYPFTRGPYPTMYRSRNWTMRQIAGFGTGEDTNKRFKYLIEQGQTGISTDFDM
PTLMGYDSDHPMSDGEVGREGVAIDTLADMEALFDGIDLEKISVSMTINPSAWILLAMYI
VLAQKRGYDLDKLSGTVQADILKEYMAQKEYIYPIAPSVRIVRDCITYCAKNMKRYNPIN
ISGYHISEAGSSPVDEVAFTLANLIVYVEEVLKTGMKVDDFAPRLAFFFVCQADFFEEIA
KFRAVRRCYAKIMKERFGARNPESMRLRFHCQTAAASLTKPQFMVNVVRTTLQALAAVLG
GCQSLHTNGFDEAFAIPTEEAMRLALRTQQVIAEESNVTQVIDPVGGSYYVETLTTEYEK
RIMDIISEVDARGGTIKLIQEGWFQKSVADFAYETALRKQSGEKPVIGVNTMVDESEVHE
IELHPYDHTTADRQIARTQRVRRERDNVKVSALLDRLVEVAKDETQNIMPVTIELVREGA
TMGDIVERLKTVWGVYRETPVF
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgagcatgtctgagatcatgaccctcgccaatctcgacgacgacgtgcgtcactgggag
gagaccgaggtcgccgccttcctgaagaagcagaaggagcgcaaggagcagttcttcacc
ctcggcgacttcccggtgaagcgcgtctacaccgccgccgacgcggcggcgacgccgatc
gaggacatcgggctgcccggccgctaccccttcacccgcggcccctatcccaccatgtac
cgcagccggaactggaccatgcgccagatcgccggcttcgggaccggcgaggacacgaac
aagcgcttcaaatacctgatcgaacaggggcagaccggcatctccaccgacttcgacatg
ccgaccctcatgggttacgacagcgaccatccgatgagcgacggcgaggtgggccgcgag
ggcgtggccatcgacacgctcgccgacatggaggcgctgttcgacgggatcgatctcgag
aagatctcggtctcgatgaccatcaatccgtccgcgtggatcctgctcgccatgtatatc
gtgctggcgcagaagcgcggctacgacctcgacaaattgtccggcaccgtccaagcggac
atcctgaaggagtacatggcgcagaaggaatatatctatcccatcgcgccttccgtgcgc
atcgtgcgcgactgcatcacgtactgcgccaagaacatgaagcgctacaaccccatcaac
atttccggctaccatatctccgaagccggctcctctccggtggacgaggtggccttcacc
ctggcgaacctcatcgtctatgtggaggaggtgttgaagaccggcatgaaagtggatgac
ttcgccccgcgcctcgccttcttcttcgtctgccaggccgacttcttcgaggagatcgcc
aagttccgcgccgtgcggcgctgctacgccaagatcatgaaggagcgcttcggggccagg
aacccggaatccatgcgcctgcgcttccactgccagaccgccgccgcctcgctcaccaag
ccgcaattcatggtgaacgtggtgcgcacgacgctgcaggcgctggcggcggtgctgggc
ggctgccagtcgctgcataccaacggcttcgacgaggcgttcgccatccccaccgaggag
gccatgcgccttgccctgcgcacccagcaggtgatcgccgaagaaagcaacgtcacccag
gtgatcgatcccgtggggggctcctattatgtggagacgctcaccaccgagtatgaaaag
cgcatcatggacatcatctccgaggtggacgcgcgcggtggcaccatcaagctgattcaa
gaaggctggttccagaagagcgtcgccgacttcgcctacgagacggcgctgcgcaagcag
tcgggcgaaaagccggtgatcggcgtaaacaccatggtggacgaaagcgaggtgcatgag
atcgaattgcacccttatgaccacaccaccgccgaccgccagatcgcccgcacccagcgg
gtccgccgtgagcgcgacaatgtgaaggtcagcgcgctgctcgaccgcctggtggaggtg
gcgaaggacgagacccagaacatcatgcctgtcaccatcgagctcgtgcgtgaaggcgcg
accatgggcgacatcgtggagcggctgaagacggtgtggggcgtgtatcgcgaaacaccg
gtgttctga

DBGET integrated database retrieval system