Xanthomonas bundabergensis: AB3X10_17180 Help Entry AB3X10_17180      CDS       T10887                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism xbn  Xanthomonas bundabergensis Brite KEGG Orthology (KO) [BR:xbn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xbn03032]     AB3X10_17180    03036 Chromosome and associated proteins [BR:xbn03036]     AB3X10_17180    03400 DNA repair and recombination proteins [BR:xbn03400]     AB3X10_17180 DNA replication proteins [BR:xbn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AB3X10_17180 Chromosome and associated proteins [BR:xbn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AB3X10_17180 DNA repair and recombination proteins [BR:xbn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AB3X10_17180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Phage_sheath_domII Lmo2446-like_N HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  XEA89888 LinkDB All DBs Position complement(4075332..4075604) Genome browser AA seq 90 aa AA seqDB search MNKAELNDAIAAAADISKAEAGRAVDAFVSEVTKALKKGDSVTLVGFGTFQVRDRAERTG RNPKTGDSIKIAASKNPTFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaagccgaactgaacgacgctatcgccgccgctgccgatatctccaaggccgaa gccggtcgcgccgtcgacgccttcgtgtccgaagtcaccaaggcgctcaagaagggcgac agcgtgaccctcgtgggcttcggcaccttccaggtgcgcgaccgtgccgagcgcaccggc cgcaacccgaagaccggcgactcgatcaagatcgccgcgtcgaagaatccgaccttcaag gctggcaaagcgctgaaggatgccgtaaactaa

DBGET integrated database retrieval system