Xanthomonas citri pv. citri mf20: J172_01881 Help Entry J172_01881        CDS       T03781                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism xcf  Xanthomonas citri pv. citri mf20 Pathway xcf02024   Quorum sensing xcf03018   RNA degradation Brite KEGG Orthology (KO) [BR:xcf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     J172_01881  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     J172_01881  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xcf03019]     J172_01881    03036 Chromosome and associated proteins [BR:xcf03036]     J172_01881 Messenger RNA biogenesis [BR:xcf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      J172_01881 Chromosome and associated proteins [BR:xcf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J172_01881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AJZ08453 UniProt:  A0A0U4YKM5 LinkDB All DBs Position 1994336..1994614 Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaggacccatttctcaatgcgctgcggcgcgagcgagtg cccgtgtcggtgtatctggtcaatggcatcaagctgcagggcacgatcgagtcgttcgac caattcgtggtcctgctgcgcaataccgtgagtcagatggtgtacaagcacgccatttcc acggtggtgccggcgcgcaacgtgcgcgtggggcctggtggtgggtatgtgcaatccaat gaaggcaatcaggcggaagatgacgacgtcgagcagtaa

DBGET integrated database retrieval system