KEGG   Xiphophorus couchianus (Monterrey platyfish): 114133271
Entry
114133271         CDS       T05908                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
SSDB
Motif
Pfam: MRAP PMT_4TMC Cadherin_C_2
Other DBs
NCBI-GeneID: 114133271
NCBI-ProteinID: XP_027854831
LinkDB
Position
18:7426753..7427984
AA seq 124 aa
MFRSTSALHSSNRTASYFSKNDTIVPGNSTSAPLYEWEYYLDYLDPVFVDESQLKYHKYS
IVIILWVSLAAFVGFLFLILNLMSLSVKLPKINKSKVKRHHKSSTASPASADSGDGSDGC
LNPR
NT seq 375 nt   +upstreamnt  +downstreamnt
atgttcagatcgacttcggctcttcactctagcaacagaacagcaagctatttctccaaa
aatgacactattgttccggggaactccaccagtgctcctctgtatgaatgggagtactac
ttggattatcttgatcctgtttttgtggatgagagccagctgaaataccataaatactca
attgtcataatactctgggtatctctggctgcttttgtgggatttctctttctcattttg
aacctaatgtctctcagtgtgaagttgccaaagataaacaaatctaaagttaagcgtcac
cacaaaagctcaactgcttcacctgcttcggctgattctggagatggctccgatggctgt
ttgaatcctcgttga

DBGET integrated database retrieval system