Xanthomonas citri pv. citri MN10: J162_01878 Help Entry J162_01878        CDS       T03779                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism xcw  Xanthomonas citri pv. citri MN10 Pathway xcw02024   Quorum sensing xcw03018   RNA degradation Brite KEGG Orthology (KO) [BR:xcw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     J162_01878  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     J162_01878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xcw03019]     J162_01878    03036 Chromosome and associated proteins [BR:xcw03036]     J162_01878 Messenger RNA biogenesis [BR:xcw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      J162_01878 Chromosome and associated proteins [BR:xcw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J162_01878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AJZ04022 UniProt:  A0A0U4YKM5 LinkDB All DBs Position 1983603..1983881 Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaggacccattcctcaatgcgctgcggcgcgagcgagtg cccgtgtcggtgtatctggtcaatggcatcaagctgcagggcacgatcgagtcgttcgac caattcgtggtcctgctgcgcaataccgtgagtcagatggtgtacaagcacgccatttcc acggtggtgccggcgcgcaacgtgcgcgtggggcctggtggtgggtatgtgcaatccaat gaaggcaatcaggcggaagatgacgacgtcgagcagtaa

DBGET integrated database retrieval system