Xenorhabdus doucetiae: XDD1_0420 Help Entry XDD1_0420         CDS       T03784                                  Symbol hfq Name (GenBank) Protein hfq   KO K03666   host factor-I protein Organism xdo  Xenorhabdus doucetiae Pathway xdo02024   Quorum sensing xdo03018   RNA degradation Brite KEGG Orthology (KO) [BR:xdo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     XDD1_0420 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     XDD1_0420 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xdo03019]     XDD1_0420 (hfq)    03036 Chromosome and associated proteins [BR:xdo03036]     XDD1_0420 (hfq) Messenger RNA biogenesis [BR:xdo03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      XDD1_0420 (hfq) Chromosome and associated proteins [BR:xdo03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     XDD1_0420 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  CDG16123 UniProt:  A0A068QMN5 LinkDB All DBs Position 405343..405645 Genome browser AA seq 100 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHGNNQGVPTGVGNYHAGTNPAAQQESDGAE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctgcaagatccattcctgaacgctttacgacgtgaaagggtc ccggtttctatttatttggtcaacggcatcaaattacaggggcagattgaatcttttgac caatttgtcattttactgaaaaacacggttagccagatggtctataaacatgccatctct actgttgtgccttcccgcccagtgtcccaccatggtaacaaccagggtgtgccgactggc gttggaaattatcacgctggcactaacccagcagcacaacaggaaagcgatggcgctgaa taa

DBGET integrated database retrieval system