Xenia sp. Carnegie-2017 (soft corals): 124442330 Help Entry 124442330         CDS       T08024                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism xen  Xenia sp. Carnegie-2017 (soft corals) Pathway xen04814   Motor proteins Brite KEGG Orthology (KO) [BR:xen00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     124442330  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:xen03037]     124442330    04812 Cytoskeleton proteins [BR:xen04812]     124442330 Cilium and associated proteins [BR:xen03037]  Motile cilia and associated proteins   Dynein arm    124442330 Cytoskeleton proteins [BR:xen04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      124442330 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  124442330 NCBI-ProteinID:  XP_046848787 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDEFQNSEETTFVVDEVSNIIKESVEGAIGGNAYQHNKVNQWTSNVVEQCLNQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgaatttcaaaattcagaagagacaacgttcgtcgtcgatgaagtcagcaatatt atcaaggagtcagtggagggggccattggtggaaatgcatatcagcataacaaagtcaac caatggacttcaaatgttgtggagcaatgtcttaatcagttgacaaaactgggaaagcct ttcaaatatattgttacatgtgtcatcatgcaaaaaaatggggctggtctacatactgca agttcatgttactgggataatgcaacagatggtagttgcactgtacgatgggaaaacaag acaatgtattgcattgtgagtgtgtttggactgtcaatctaa

DBGET integrated database retrieval system