Xylella fastidiosa 9a5c: XF_a0061 Help Entry XF_a0061          CDS       T00033                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism xfa  Xylella fastidiosa 9a5c Pathway xfa03030   DNA replication xfa03430   Mismatch repair xfa03440   Homologous recombination Brite KEGG Orthology (KO) [BR:xfa00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     XF_a0061    03430 Mismatch repair     XF_a0061    03440 Homologous recombination     XF_a0061  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xfa03032]     XF_a0061    03400 DNA repair and recombination proteins [BR:xfa03400]     XF_a0061    03029 Mitochondrial biogenesis [BR:xfa03029]     XF_a0061 DNA replication proteins [BR:xfa03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     XF_a0061 DNA repair and recombination proteins [BR:xfa03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      XF_a0061   TLS (translesion DNA synthesis) factors    Other SOS response factors     XF_a0061 Mitochondrial biogenesis [BR:xfa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     XF_a0061 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB tRNA_anti-codon Motif Other DBs NCBI-ProteinID:  AAF85629 UniProt:  Q9PHE7 LinkDB All DBs Position pXF51:complement(47835..48245) Genome browser AA seq 136 aa AA seqDB search MASLNKMQLIGNLGADPDIRYMQDGTPTVTVSVATTDTWKDKDTGNKEEKTEWHRVVFFG GLAEIVGEFLKKGSQIYVEGALRSRNWTDKEGNKRYTTEIMAKEMQMLGKKQDNNKVGNA RHGDALPADEDDYYDF NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcatcacttaacaaaatgcaactcatcgggaatcttggagcagacccagacattcgc tacatgcaggacggcacgccaaccgtgaccgtgagcgtcgccaccactgacacatggaaa gataaggacaccggaaataaggaggaaaagacggaatggcaccgcgtcgttttcttcggg ggcttggctgaaatcgtgggcgaatttctcaagaagggttcgcaaatctacgttgaaggc gcgctacgaagtcgcaattggacggacaaggaaggcaacaagcgctacaccaccgaaatc atggcgaaggaaatgcagatgcttggcaagaagcaagataacaacaaggtggggaacgcg cggcatggcgatgcactgcccgctgatgaggatgactattacgatttctaa

DBGET integrated database retrieval system