Xylella fastidiosa M23: XfasM23_1991 Help Entry XfasM23_1991      CDS       T00692                                  Name (GenBank) putative dehydratase   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism xfn  Xylella fastidiosa M23 Pathway xfn00061   Fatty acid biosynthesis xfn00780   Biotin metabolism xfn01100   Metabolic pathways xfn01212   Fatty acid metabolism xfn01240   Biosynthesis of cofactors Module xfn_M00083   Fatty acid biosynthesis, elongation Brite KEGG Orthology (KO) [BR:xfn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XfasM23_1991   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     XfasM23_1991  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:xfn01004]     XfasM23_1991 Enzymes [BR:xfn01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      XfasM23_1991 Lipid biosynthesis proteins [BR:xfn01004]  Fatty acid synthase   Component type    XfasM23_1991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ApeI-like FabA Motif Other DBs NCBI-ProteinID:  ACB93390 UniProt:  B2I9D5 LinkDB All DBs Position complement(2230682..2230969) Genome browser AA seq 95 aa AA seqDB search MEFSIPKTHPCFPGHFPGFAVVPGVLVLAQVLHALQVREGRLTGICLPQVKFLRSLLPEQ QARIELEGAMPRWRFRVCCADTLLASGEIVAGSGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggaattttccattcctaagacgcacccctgttttcctggtcactttcctggctttgca gtggtgcctggggtgttggtgttggcgcaggtgttacatgctttgcaggtacgcgaaggc aggttgaccgggatctgtctgccacaggtcaaattcttgcggtcgctgctgccggagcag caagcgcggatcgagctggagggagccatgccgcgctggcgtttccgggtttgctgtgcg gacactcttttggccagcggcgagattgttgctgggtcgggggcatga

DBGET integrated database retrieval system