Xanthomonas graminis: KFS84_11930 Help Entry KFS84_11930       CDS       T10672                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism xgm  Xanthomonas graminis Pathway xgm02024   Quorum sensing xgm03018   RNA degradation Brite KEGG Orthology (KO) [BR:xgm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KFS84_11930 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KFS84_11930 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xgm03019]     KFS84_11930 (hfq)    03036 Chromosome and associated proteins [BR:xgm03036]     KFS84_11930 (hfq) Messenger RNA biogenesis [BR:xgm03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KFS84_11930 (hfq) Chromosome and associated proteins [BR:xgm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KFS84_11930 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UKE53106 LinkDB All DBs Position complement(2699744..2700019) Genome browser AA seq 91 aa AA seqDB search MSKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQQNEGGSAEDDEAE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccaaggggcaatccttacaggatcctttcctgaacgcgctgcgtcgcgagcgggtg ccggtttcggtgtacctggtcaacggcatcaagctgcaaggtaccatcgagtccttcgac cagttcgtggtgctgttgcgcaacaccgtgagccagatggtctacaaacacgccatttcc accgtggtgccggcacgcaacgtgcgcgtcggaccgggcggtggttatgtgcagcagaac gagggtggtagtgcggaagatgacgaagccgagtaa

DBGET integrated database retrieval system