KEGG   Xenopus laevis (African clawed frog): 108696583
Entry
108696583         CDS       T01010                                 
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00250  Alanine, aspartate and glutamate metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108696583
Enzymes [BR:xla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     108696583
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     108696583
SSDB
Motif
Pfam: RimK ATPgrasp_ST GSH-S_ATP ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Synapsin_C Rimk_N CCDC24
Other DBs
NCBI-GeneID: 108696583
NCBI-ProteinID: XP_018081570
UniProt: A0A1L8FMB7
LinkDB
Position
7L:complement(98674977..98697290)
AA seq 379 aa
MCSQLWLLTDRHIQDDYPQMRILEALKKRCADHNVDFTFVLMDQIALTVTDGQLGLQINQ
KTVTAYPQVILVRVPTPTVQSDSDITVLRHLEKLGCRLVNRPQAILNCINKFWTFQELAG
HGIPLPDTFSYGGHDEFSKMIEAAEPLGYPVVVKNTRGHQGKAVFLARDKHHLLDISHLV
RHDAPYLFQKYVKESHGKDVRVVIVGGRVVGSMLRCSTDGRMQSNCCLGGVGIPCPLSEQ
GKLLAIQVSTILGMDVCGIDLLLQDNGSFVVCEANANVGFTEFDQACKLDLGDIIAEYAL
SLLPCRVSEEKAAAPAEPNSQETEETTAHASTHPASVCSASDASCCSESAADVEEIRDSL
NVPKPCSPVLADSFHDIHK
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtgctcccagctgtggctcctcacggacagacacatccaggacgattacccgcagatg
cgcatcctggaggctctgaagaagcgctgcgctgatcacaatgtggacttcactttcgtc
ttgatggatcaaattgccctcactgtcactgacggacagctgggcttgcaaattaaccag
aagactgtgactgcttaccctcaggtgatactggtgcgggtgccaacaccaactgtgcag
tccgatagcgatataactgtactgaggcatcttgagaaacttggctgtcgccttgttaat
cgtccgcaagccattttaaactgcataaataagttctggacatttcaggaattagctggc
catggcatacctttaccggacaccttctcctatggtggccacgatgagttttcgaaaatg
atagaagcagcagagcctttagggtatcccgtagttgtaaaaaacaccagaggacatcaa
ggaaaagcagtgtttcttgcaagagataagcaccacctgttggatatatcccacttggtg
cgccatgatgcaccctacctttttcagaagtatgtcaaggagtctcatgggaaggatgtc
cgtgtggtgattgttggaggacgagtggttgggtcgatgttgcgctgttccactgatggc
aggatgcaaagcaactgctgcttaggtggggttggcatcccgtgcccccttagtgaacaa
gggaaactgttagctattcaagtatccaccattctgggtatggatgtatgtggtattgac
ctccttctacaagataacggatcctttgtggtttgtgaggcaaatgcaaatgttggcttt
accgaatttgaccaagcgtgtaaattagatcttggtgacattattgcagagtatgccttg
tctctcctcccatgtagggtatcagaagagaaggctgcggcgcctgcagaacccaactcc
caggaaactgaagaaacaacagcacatgctagtactcaccctgctagtgtttgtagcgct
agtgatgcctcgtgttgcagtgagagtgctgctgatgttgaagaaatcagggattctctt
aatgtgccaaagccatgctccccggtgttagcagatagtttccatgacatccataagtaa

DBGET integrated database retrieval system