Xenopus laevis (African clawed frog): 779088 Help Entry 779088            CDS       T01010                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism xla  Xenopus laevis (African clawed frog) Pathway xla04010   MAPK signaling pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04218   Cellular senescence xla04371   Apelin signaling pathway xla04519   Cadherin signaling xla04625   C-type lectin receptor signaling pathway xla04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     779088    04371 Apelin signaling pathway     779088   09133 Signaling molecules and interaction    04519 Cadherin signaling     779088  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     779088    04137 Mitophagy - animal     779088   09143 Cell growth and death    04218 Cellular senescence     779088   09142 Cell motility    04810 Regulation of actin cytoskeleton     779088  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     779088  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     779088    04031 GTP-binding proteins [BR:xla04031]     779088 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    779088   Exosomal proteins of bladder cancer cells    779088 GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     779088 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 RHG35-p190PhoGP_pG1 Motif Other DBs NCBI-GeneID:  779088 NCBI-ProteinID:  XP_018112727 UniProt:  A0A8J0UU85 LinkDB All DBs Position 4L:1949315..1963231 Genome browser AA seq 171 aa AA seqDB search MSHGSGQEKQRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLD ILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDKGSFEEIYKFQRQILRVKDRDEFPMILV GNKADLEHLRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVVR NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgtcacacgggtctgggcaggagaagcagcggctggtggtcgtgggaggaggcggggtc gggaagtcagcgctcaccatccagtttatccagtcttactttgtgacggattacgaccca acgattgaagattcctacaccaagcaatgcgtcatagacgacagagcagcgcgattggac attctggacacggcggggcaggaggagttcggggcaatgagggagcagtacatgaggaca ggagaggggttcctgctcgtattttcggtcacagacaagggaagttttgaagaaatctat aaattccaaagacagatcctgcgagtaaaagaccgggatgaatttcccatgattctggtt ggcaacaaggctgacttggagcacctgaggcaggtaacacaggaggaggggcagcagttg gcacggcagctcaaagtcacatacatggaggcttcagcgaaaatcagaatgaatgtagac caagcttttcatgaacttgttagagttgtaaggtga

DBGET integrated database retrieval system