Xanthomonas oryzae pv. oryzae PXO99A: PXO_06150 Help Entry PXO_06150         CDS       T00763                                  Name (GenBank) flagellar protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism xop  Xanthomonas oryzae pv. oryzae PXO99A Pathway xop02020   Two-component system xop02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:xop00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PXO_06150  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     PXO_06150  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:xop02035]     PXO_06150 Bacterial motility proteins [BR:xop02035]  Flagellar system   Flagellar assembly proteins    Others     PXO_06150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM YdgH_BhsA-like DUF3073 Motif Other DBs NCBI-ProteinID:  ACD59338 UniProt:  A0A0J9WXF1 LinkDB All DBs Position complement(2801897..2802208) Genome browser AA seq 103 aa AA seqDB search MTQKIEGNLPTAATLRTAATSSKIASAGEDGASPVAVTPPTDSVKLTGEATNLQNLQREL SQSSAIDTGRVQAVKDALQNGSYSINPDAIASRMMDLNQQLAG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacccagaaaatcgaaggcaatctaccgaccgctgccacccttcgcaccgcggccacc agcagcaagatcgcttcggccggcgaagatggcgcgtccccagtagccgtcaccccgccg accgacagcgtcaagttgaccggcgaagccaccaacctgcagaacctgcagcgcgagctt tcgcagtcctcggcgatcgacaccggtcgcgtccaggcggtgaaggatgcattgcagaac ggcagctattccatcaacccggatgccatcgccagccgcatgatggatctgaatcagcaa ctggcgggttga

DBGET integrated database retrieval system