KEGG   Xenopus tropicalis (tropical clawed frog): 100145548
Entry
100145548         CDS       T01011                                 
Symbol
rimkla
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr00250  Alanine, aspartate and glutamate metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100145548 (rimkla)
Enzymes [BR:xtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100145548 (rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100145548 (rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST Rimk_N CPSase_L_D2 ATP-grasp ATP-grasp_3 Synapsin_C
Other DBs
NCBI-GeneID: 100145548
NCBI-ProteinID: NP_001120454
Xenbase: XB-GENE-989370
UniProt: B1H339
LinkDB
Position
7:complement(94867011..94894058)
AA seq 315 aa
MCSQLWLLTDRHIQEDYPQMRILEALKKRCADQKVDFTFVLMDQIALTVTDGKLGLQINQ
KTVTAYPQVILVRVPTPTVQSDSDITVLRHLEKLGCRLVNRPQAILNCINKFWTFQELAG
HDIPLPDTFSYGGHDEFSKMIDAAEPLGYPVVVKNTRGHRGKAVFLARDKHYLLDISHLV
RHDAPYLFQKYVKESHGKDVRVVIVGGQVVGSMLRCSTDGRMQSNCSLGGVGVPCPLSEP
GKLLAMQVSTILGYSCHREEAFVVPVLIICYEGLIKHGSCGAGCTMGSRGFMALENNLDT
GLEERGNCDLEWISI
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtgctcccagctgtggctcctcacggacaggcacatccaggaggattacccgcagatg
cgcatcctggaggcgctgaagaagcgctgtgcagatcagaaggtggacttcacttttgtc
ttgatggatcagattgcccttactgtcactgatggcaagctgggcttgcaaattaaccag
aagactgtgactgcttaccctcaggtgatactggtgcgggtgccaacgccaaccgtgcag
tccgatagtgatataactgtactaaggcatcttgagaaactgggctgtcgcctggtcaat
cgtcctcaagccattttaaactgcataaataagttctggacatttcaggaattagctggt
catgacatacctttaccagacaccttctcctatggtggccacgacgagttttcgaaaatg
atagatgcagcagaacctttagggtatcctgtagttgtaaaaaataccagaggacatcga
ggaaaggcagtgtttcttgccagagataagcattacctgttagatatatcccacttggtg
cgccatgatgcaccctacctttttcagaagtatgtaaaggagtctcatgggaaggatgtc
cgcgtggtgatagttggaggacaagtggtcgggtcgatgttgcgctgttccacggatggc
aggatgcaaagcaactgcagcttaggtggggttggtgtcccgtgccccctcagtgaacca
gggaaactgctagctatgcaagtatccaccattctgggttattcctgtcacagggaggag
gcctttgtggtcccagtgttaataatctgctacgaaggcctaataaagcatggcagctgt
ggtgctggttgcaccatggggtcaagaggattcatggcactagaaaataatcttgacacg
ggactggaggagaggggcaactgtgacttggagtggatatcaatataa

DBGET integrated database retrieval system