KEGG   Xenopus tropicalis (tropical clawed frog): 100486343
Entry
100486343         CDS       T01011                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
SSDB
Motif
Pfam: MRAP Baculo_11_kDa OAD_gamma DUF6097 SelK_SelG DUF2207 HemY_N
Other DBs
NCBI-GeneID: 100486343
NCBI-ProteinID: XP_002938489
LinkDB
Position
2:complement(15371487..15374606)
AA seq 125 aa
MIGAAKPSLILTCTQLVISGTSSAHNAMMADTGNVSYTYEDYYDYEDFASFDESEPRANK
YSIVIALWVGLAMFVVFLFLILLYMSRTVARSKNTARRKRKQMFLKGSTERPKGREHGES
SRDPE
NT seq 378 nt   +upstreamnt  +downstreamnt
atgataggagctgctaagccgtcactcatactcacttgcacccagctggtaatatctggc
actagctctgctcacaatgcaatgatggccgacaccggtaacgtttcctacacctacgaa
gactactacgattatgaggatttcgcatctttcgatgaaagtgaaccgagagcaaataaa
tattccattgtcattgcactttgggtcggccttgcaatgtttgttgtttttctgttcctt
atactgctgtacatgtccaggactgtcgccagatcaaagaacacagcaagaagaaagaga
aagcaaatgtttctaaagggaagcacagagcggccgaaaggaagagaacatggagaaagc
agcagggatcctgaataa

DBGET integrated database retrieval system