KEGG   Yinghuangia sp. ASG 101: LO772_34300
Entry
LO772_34300       CDS       T07749                                 
Name
(GenBank) SRPBCC family protein
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
yia  Yinghuangia sp. ASG 101
Pathway
yia01056  Biosynthesis of type II polyketide backbone
yia01100  Metabolic pathways
yia01110  Biosynthesis of secondary metabolites
Module
yia_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:yia00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    LO772_34300
Enzymes [BR:yia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     LO772_34300
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc Pdase_M17_N2
Other DBs
NCBI-ProteinID: UGQ11785
LinkDB
Position
8001762..8002772
AA seq 336 aa
MTAPATGSPPRKPHQLAHHIAVSAPADEVYRLLADVSGWPAMFGPTVHVEPHGPRNEHGE
ETFTIWALTGDDVSSWASRRQLDPAARRIEFRQTEPPDPVTAMGGAWIVEQGLYGGSDVT
LLHDFEVVGDDAKTVDFVCGLVDANSKAELSALRTRAELGGDADALVFGFEDSVEVRGSA
DDVFSFLWRAEAWPDALPHVAAVDLTEKDGVQTMDLHVNEPDGGTHALRSVRVALPGHRM
VYKQLVLPPVLAVHTGEWRVAATATGATAVSRHTCVLRPEAIEPMLGAGTTLAEARAAVE
RAVGGNSSTTLTRARAYAEERAGDALHAVPGRGARP
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaccgccccggccaccgggtcacccccgcgcaaaccccaccaactcgcccaccacatc
gcggtgtccgcgcccgcggacgaggtctaccgcctgctggcggacgtctcgggctggccc
gcgatgttcggcccgaccgtgcacgtggaaccacacggcccccgcaacgagcacggcgaa
gagaccttcaccatatgggcgttgaccggtgacgacgtcagctcgtgggcgtcgcggcgg
caactcgaccccgccgcacggcggatcgagttccgccagaccgaacccccggacccggtg
acggcgatgggcggcgcgtggatcgtcgaacagggcctgtacggcggctccgacgtcacc
ctgctgcacgatttcgaggtcgtcggcgacgacgcgaagaccgtcgacttcgtctgcggc
ctggtcgacgccaacagcaaagccgagctgtccgcgctccgcacccgcgccgaactcggc
ggcgacgccgacgcgttggtcttcggcttcgaggacagcgtcgaggtgcgcggcagcgcg
gacgacgtcttctccttcctgtggcgcgccgaggcctggcccgacgcgctcccgcacgtc
gccgccgtcgacctcaccgagaaggacggcgtccagaccatggacctgcacgtcaacgaa
cccgacggcggcacgcacgcgctccgctcggtccgcgtcgcgctgcccgggcaccgcatg
gtctacaagcagctggtgctgccgccggtcctcgcggtgcacaccggcgagtggcgcgtg
gcggccaccgcgaccggggcgacggcggtgtcgcggcacacctgcgtcctgcggcccgag
gcgatcgagccgatgctcggcgccggcaccacgctcgccgaggcgcgcgccgcggtcgag
cgcgcggtcggcggcaacagctccaccacgctcacccgggcccgcgcgtacgccgaggag
cgcgcgggcgacgcgctgcacgccgtcccgggcaggggagcgcgcccgtga

DBGET integrated database retrieval system