KEGG   Zygotorulaspora mrakii: HG535_0E01390
Entry
HG535_0E01390     CDS       T06976                                 
Name
(RefSeq) uncharacterized protein
  KO
K06663  DNA damage checkpoint protein
Organism
zmk  Zygotorulaspora mrakii
Pathway
zmk04111  Cell cycle - yeast
zmk04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zmk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    HG535_0E01390
   04113 Meiosis - yeast
    HG535_0E01390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zmk03400]
    HG535_0E01390
DNA repair and recombination proteins [BR:zmk03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    HG535_0E01390
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 59236797
NCBI-ProteinID: XP_037144782
LinkDB
Position
5:302279..304030
AA seq 583 aa
MSFKATITGPERQALWARTVNVLSSLNKNIMFTVSSTELITWTTDNAETALCKIRFSRQF
FDEFIFNPHEIIFGEEGVQIVTDTEGVDHGLYSFQVSGSYLGTITKKTEGDTIQKFTIAI
NNTTTCSDFLANRLLIYMEMESLICKQHSLQLVPVKYDPIIIDIKYKKKFLEVYGSSQDG
EMIDPRLDQILRVTEADVRTALFHEETEKLNQKKDHLTLADEINYICCSQVLLKNFIDHC
NPNLTRELKLEINTSRLSLTAFSHAVHGKNNKPLKNALSFTDTISTLDLEQSCLFTTIDE
DTMDDDQNVIGHNAQKREHTKNIIFSLADFKKFMNIISSWKNSNESNVDIWFRHRGEPIM
FEVRKPDVILELVQVTVADGVAVVENIPPSSSVKCQTMMKGTSPEKARAREQVTKEEMGL
LRISPVKTIAPNKNKSKSPLKYGKPISPRRKIKRELFVNDSSQDIPSSDAKKQKPWTSLS
TDWKDDASLDKSTDVVRHEGDDINNNFNSTIAEKSATTVEWGVTPQDHQNNESKIDKRSL
LRKEKFKYFQDLKTERDALKKKDPSQPEGFGPTQVSKPKGLFD
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtcattcaaggcaactatcactggaccagaaaggcaggcactatgggctcgtactgtt
aatgtcttaagtagtctgaacaagaatattatgtttacagtgtcatcaaccgagctgatt
acatggactactgacaacgcagagacagcactatgcaagatacgattttcccgacagttt
tttgatgagtttattttcaacccacatgaaataatatttggagaggagggcgttcagatc
gtcactgacactgaaggagtagatcacggtctgtattcattccaggtgagcggtagttat
ttaggcacaataacaaagaaaaccgaaggagataccatacagaaattcaccatagctatt
aacaatacaacaacatgttcggattttttggctaatagacttttgatctatatggaaatg
gaatctctaatctgcaagcagcattcgctacaactcgttcctgtaaagtacgatccaatt
ataatagatatcaagtacaagaagaaatttttggaagtttatggatcgtcacaagatgga
gagatgatagatcctagactggaccagattctcagagtcactgaagcagatgtaagaaca
gcattgtttcatgaagaaactgaaaagttgaaccaaaaaaaagaccacctaacgcttgca
gatgagatcaattacatatgctgtagtcaagttctcctcaaaaacttcattgatcattgc
aaccctaaccttaccagagagctgaaactagaaatcaatacaagcaggttaagtttgacc
gcattttcacatgctgtacatggtaaaaataacaaaccactgaaaaacgcattaagtttc
accgatacgataagcacattagatctggagcaatcttgcttatttactaccattgatgag
gatacaatggatgatgaccaaaatgtgataggccataacgctcagaaaagggagcataca
aaaaacataatattcagcctggctgacttcaaaaagtttatgaatataatatcaagttgg
aaaaatagcaacgaaagtaacgtggatatttggtttcggcacaggggagaacctatcatg
ttcgaggtacggaagcctgatgtaatactggagcttgttcaggttacggtcgccgacgga
gtagcagtggtagaaaatataccacctagtagttcagtaaaatgccaaaccatgatgaag
ggtacgtctcctgaaaaggctcgagctcgagaacaagttactaaagaagaaatgggacta
ctccgcataagtcctgtcaagaccatagcaccaaacaaaaataaaagtaaaagtccgttg
aaatatgggaaacctataagtccgcgaaggaaaatcaagagagaactttttgtaaatgat
tcttctcaagatatcccttctagcgacgccaagaaacagaaaccttggacaagcctgtca
actgattggaaggacgacgcttctctggataaaagcaccgatgtagtgcggcatgaggga
gatgacatcaacaataacttcaattctactatcgccgaaaagagtgcaacaaccgtagag
tggggtgtcacaccacaagatcaccagaataatgagtccaaaattgataaaagaagccta
cttcgaaaggagaagttcaaatattttcaagatctaaaaaccgaacgagatgccttgaag
aagaaagatccctctcaaccagagggtttcgggcccactcaggtatctaaaccgaaaggc
ttatttgactga

DBGET integrated database retrieval system