KEGG   Zygotorulaspora mrakii: HG535_0H01630
Entry
HG535_0H01630     CDS       T06976                                 
Name
(RefSeq) uncharacterized protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
zmk  Zygotorulaspora mrakii
Pathway
zmk04111  Cell cycle - yeast
zmk04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zmk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    HG535_0H01630
   04113 Meiosis - yeast
    HG535_0H01630
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 59238639
NCBI-ProteinID: XP_037146561
LinkDB
Position
8:complement(331959..333719)
AA seq 586 aa
MSSSRYKLPEIDLNEIHDENHLAPVVKAILLNHDTFVLKNHANKNILDSLVDTLNDQEIP
NRETEFDANFTGVLAVEDNILFEQYIFNTDDSLPFNREMANGTLKRLYTRLFKLGLFFAK
ICLESFVPDDEYKLDENNYSSVISRFFNNSPTGSQTLPTGEIFEYAPSPDYREFLPTGLL
TVFPTTKGVKFKPPTFSADDNTWASFEDEDRLVLHTGSLLARLSGGRHTTSPLHISPDLN
VMHLTVSLPLSTIIDNEGKRHVDILLRQQIQELPNAASIFYPRQTALLRLERQINLYKEM
FSVCETVLSLYSISRSSAVKPELYSLLPQISNMMRRKTSQDDFLRMVSIWPQSYVIEANS
KCELTVKLPNNSSSLAFTNKSRRLQYVEKADAWYNDMCRKEVIPNGIPLLKINKRRGSSG
TFNRSSVDNMKTKARNSSNRPLYLSNSKEKYMYPEKKHDSQMNLLERLREKERRSAALLS
QRQRQYQQFLTVKVNQVFDILQSLQWGNPYTVTYLSTLIVDSLEDTNNPIGYKEAEEILL
KLQNLLNDEISVQTVEGGLKVYRWNTLNKEILASRIHQEEMDQSQE
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgagctccagcaggtacaagttacctgagatagatctcaacgagatccacgatgaaaac
catttggcgccagtggtgaaagccatcctcttgaatcatgacacatttgtgttgaaaaat
cacgccaataaaaatatattggactctctagtggatacgcttaatgatcaggagatcccc
aacagagaaacggagttcgatgccaactttacaggtgtcttagcagttgaggacaatatt
ctctttgagcaatatatcttcaacacagatgatagcctgccattcaaccgcgagatggcc
aatgggacgctgaaaagattgtacacgaggctcttcaaactgggactattttttgctaaa
atctgcctcgagagctttgtgcccgacgacgaatacaagctagatgagaataactactcg
agcgtgataagccgtttttttaataacagtcctacgggctcacaaaccctgccgacggga
gagatatttgaatatgctcccagccccgattatagagagtttctgccgactggtttactg
acagtattccccactaccaaaggtgtcaaattcaaacctccgacgtttagtgctgacgat
aatacgtgggcatcttttgaagatgaagatcgtcttgtactgcatacaggatcgttactg
gcgagattgtcggggggtaggcataccacgtcgcctttgcacatctcgcctgatctcaac
gttatgcatcttactgtgtcattaccattgagtactatcattgataatgagggcaaaaga
catgtcgatattttactacgtcagcagattcaagaattacccaatgcagcatctattttc
tatccacgacaaaccgcgttattgcgcttagaaagacagatcaatctttacaaagaaatg
ttttccgtatgtgaaaccgttctatctttatattctatttcaagatcgtccgctgtaaag
ccagagctttactcgcttttgccccagatttctaatatgatgaggagaaaaacctcacaa
gacgattttctaagaatggtatcaatatggcctcaatcttatgtcattgaggcaaactcc
aaatgtgagctaactgtcaagctgccgaataatagttcatccctcgctttcactaacaag
tcaaggcgtttacaatacgtagaaaaggcagatgcatggtataacgatatgtgcaggaaa
gaagtcattccgaatggcataccccttttgaagatcaataaaagaaggggtagttcaggt
accttcaatagaagtagtgttgataatatgaaaacaaaggctcgaaactcttcaaacaga
cctttgtacttatcgaattcaaaagaaaaatatatgtacccagagaaaaagcatgattcg
caaatgaatcttcttgaaagattaagagagaaggaaagacgatcagccgctttactatca
caaaggcaaagacagtatcaacagtttttaaccgttaaagttaatcaagtatttgatatt
ttgcaatccttgcaatggggtaatccatatacagtcacctacctgagtacattaatcgtc
gacagccttgaagacacgaataatccaattggatacaaagaagccgaagaaattcttctg
aaattgcaaaatttactcaatgatgaaatttctgttcagactgttgaaggtggactgaaa
gtttatcgatggaatactttgaataaggaaatacttgcatcaaggattcatcaagaggaa
atggatcagtcacaagagtga

DBGET integrated database retrieval system