KEGG   Zygosaccharomyces rouxii: ZYRO0F05060g
Entry
ZYRO0F05060g      CDS       T01118                                 
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04111  Cell cycle - yeast
zro04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    ZYRO0F05060g
   04113 Meiosis - yeast
    ZYRO0F05060g
SSDB
Motif
Pfam: CDT1 CDT1_C FIN1
Other DBs
NCBI-GeneID: 8205177
NCBI-ProteinID: XP_002497417
UniProt: C5DXH3
LinkDB
Position
F:422386..424170
AA seq 594 aa
MASHKLPVIDLNEISDEQELLPAVKSILLNDDTFLLRNYANIKQLDGLLYNLNHSELPDE
QQGIDPNFTGVSNLGDNLFLEQYIANTDDQLQFNRQCNNASLNNLYTRLFKIGIFFANLC
IRSVVLDDENQKNANISQNQYFTKITRYFYQDQTSQELPSGEIFEYPLNHDYVSHSPVGI
ITIFPQATNIKYKPSTISSDDNVWISIDEPDCLLLHTGSLLANLSNGIHTTSPLKICPQS
NTVHLTIGPPLNTVVDSARGDTLAKCLLKQQIEDFPQIAQKFYPKEMAQLQLSKSLQFYK
NLFSACETVLSLFVMSRSLGSPIELYSIFPQLSNMMRKKITQDDFLKMVSLWPECYSLKS
NSRGELIIGLPERNVLATLVNKSRRLEYSERADAWFQKAVNQQTVITDVPAVKMGKRRGS
DNIGTDGSMIRQKLTSMALPREKRYLANPKERFMNPEKNTDSQSNLLERLRERERKSSAL
LSQRQRHYQQFLTVKMKQVFGILHSLPWNRPYTVTYLTGLVVDSLQDSNNPIGISEAEEI
LEKLQSLLCDEISFQIVDGGLKVYRWTQLDKDSLSAKIDTMSREELTNNVDTGL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcttcacataaattaccagtaattgatttaaatgaaatatctgatgaacaagaattg
ttaccggctgttaagtcaattctattaaatgatgatactttccttttgagaaactatgct
aatataaagcaattggatggccttttatacaatctaaatcattctgaactacctgatgaa
caacagggaatcgatccaaattttacgggggtttcaaatctaggcgataatcttttcctg
gagcagtatatcgctaatacggatgatcaattacaatttaacagacagtgtaacaatgcg
agtctaaacaatttatacactcgtttattcaagatcggaatattttttgctaatctgtgc
ataagatccgtagtactcgatgatgaaaaccaaaagaatgctaatatttcacagaatcaa
tacttcaccaaaatcacaagatatttttatcaagatcaaacctctcaagaattgccaagt
ggtgaaatttttgaatatccattgaatcatgattatgttagccattctccagtagggata
ataactattttccctcaagctaccaatattaaatataaaccatctacgataagttcagat
gataacgtatggatttcaattgatgaaccagattgtcttcttcttcatacaggatctttg
ttggctaatttatcaaatggaattcataccacttccccattgaagatttgcccgcaaagt
aataccgttcatctcactatcggaccacctttaaacaccgttgtcgatagcgctagaggt
gatactttggctaaatgtttgcttaaacaacagattgaggatttcccacaaattgcgcaa
aaattttacccaaaggaaatggcacagctacaattgtctaaatcgttacaattttacaaa
aatctattttccgcctgtgaaactgtattatcgctatttgttatgtcgagatcgctaggt
tctcccattgaattatattccatattcccacaattgtccaacatgatgagaaaaaagatc
acacaggatgattttttaaagatggtttctctatggccggagtgttatagtttaaagtcc
aattcaagaggtgagttaatcattggcctgccggagaggaacgtattggctacattggtg
aataaatcaagacggttggaatattcagaaagggcagatgcatggtttcaaaaggcggtt
aatcaacagacagtgataactgacgttcctgccgttaaaatgggtaaaagaagaggtagc
gacaatattggtactgatggctctatgattagacagaagctaacatcgatggcattgcca
agagaaaaaagatatcttgctaatcccaaggaaagattcatgaatcctgaaaaaaacacc
gattcacaatccaatcttctggaaagattacgtgaacgtgaaagaaaatcatcagcttta
ttatcacagagacagagacattatcaacaatttttgactgtcaaaatgaaacaagtcttt
ggaattctccattccctaccttggaacaggccatatactgttacttatctcactgggctc
gttgtggatagtcttcaagatagtaataatccaattgggatttcggaggcagaagaaatc
ttggaaaagttgcaaagtctgctttgcgacgagatatcgttccaaattgtggatggcggt
ttaaaggtctacaggtggactcaattggataaagattcattatccgccaaaatagatact
atgagtcgcgaagaactgacaaataacgtagatacaggattgtag

DBGET integrated database retrieval system