KEGG   Zygosaccharomyces rouxii: ZYRO0G08492g
Entry
ZYRO0G08492g      CDS       T01118                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04111  Cell cycle - yeast
zro04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:zro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    ZYRO0G08492g
   04113 Meiosis - yeast
    ZYRO0G08492g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zro03400]
    ZYRO0G08492g
DNA repair and recombination proteins [BR:zro03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    ZYRO0G08492g
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 8206168
NCBI-ProteinID: XP_002498365
UniProt: C5DZZ8
LinkDB
Position
G:complement(688463..690133)
AA seq 556 aa
MSFKATFQDSEKHNIWFRTVSALTTVRKDINFTITSAELIAWAINTTDTTLCQVRFARSF
FEDYEFKPYEIVFGEDGVQIVPDSHGTDQKLYSFEVNGRHLTTISKKPDGDSVNEFTIAI
NNTASCPDVLANRLLIHIEMSSLISKDYTPQFTPIKYDPIVIDLKYKRKFLDVYGSKSRS
VQETLNHRLSEIFVEAERELSTALFNENNEPNPKDMNQLTMADEINLVCCNQALIKNFLD
NCNPNITEEMKLEISHQKLCVTAFTKAIYGKNNDVLRNNISLSNTISTSDLECHCLFLKE
INNGDKGDDGTKSIVFKLKDFKNFMSIGSSGKSSLSGNLNIWFCHRGEPLLVELNRPDVK
SELVQITDSSGMANAENENAITKATATVSPNTRASREPFKAEPFLPRVSPLKSSSVPSKE
TRRSPLKNMGGSIPNKSSITRQLFVKEDDEHPLSVWNHEEEELKREQPEPNEEILLAAPA
ERSRTTVGWGQRPLEPDHSLKPMDKQSMLKQEKRKYLQELKDEQKRQKREINDRSTQESQ
EGLGPTQPNRPKGLFD
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtcatttaaggcaacttttcaggattcagaaaaacacaatatatggtttcgtacagtt
tctgctttaaccacagtacggaaagacatcaactttactataacatccgccgagctcatt
gcatgggccatcaataccacggacacgacgttgtgtcaggtgaggtttgcacgcagtttc
tttgaagattatgaatttaaaccatatgaaattgtatttggtgaggacggcgtacagata
gtacctgattctcatggtaccgatcagaaattgtactcttttgaagtgaatggaagacat
ttgacaactatatcaaagaaacctgatggcgattctgtaaatgaatttacaatagcgatt
aataatactgctagttgtcctgatgttttagcaaatcggcttttaatccacatcgaaatg
tcatctttgataagcaaggattatacacctcagtttacgccaattaaatatgatcctatt
gtcatcgatttgaaatacaagagaaaattcttagatgtctatggatcgaaatcgcgatct
gtacaggaaacattaaaccatagactttctgaaatatttgttgaggctgaacgtgaacta
tcaacagctcttttcaatgaaaataatgaaccaaaccccaaggatatgaatcaattaacc
atggctgatgagattaatctcgtctgttgcaaccaagctctcatcaaaaattttcttgac
aattgtaatccaaatattacagaggagatgaagttggaaataagccatcaaaaattatgt
gtaaccgccttcactaaggctatctatggaaaaaataacgacgttttaagaaacaacata
agcctaagcaataccattagcacgtctgatttggagtgccactgtcttttcctcaaagaa
attaacaatggagataagggagacgatggtactaaaagtattgttttcaaattaaaagat
tttaaaaattttatgagtatagggtcatcggggaaatcaagcctgagtggtaatttaaac
atatggttttgtcatcgtggcgaaccattgctggtagagttaaacagacccgatgttaaa
tctgaactcgtacaaataactgatagtagcggtatggctaatgccgaaaatgaaaacgca
attaccaaggcgacagccactgtttcgccaaatacaagagctagtagagaacctttcaaa
gctgaaccattcttacctcgtgttagtccattaaaatcctcctcggtaccgagcaaggaa
acaagaagaagtccattaaaaaatatgggcggcagtataccgaataaaagtagtataaca
agacaattgtttgtcaaagaagatgatgaacatccattgagtgtatggaaccatgaagaa
gaagaactcaagagggaacaaccggaacctaacgaagaaattttgctggcggcaccagca
gagagatctcgcacaacagtcggttggggtcaaagaccattggaaccagatcatagtctt
aaaccaatggataaacaaagcatgttaaagcaagaaaaacgcaaatatttacaagaatta
aaggatgaacaaaagaggcagaagagagagataaatgaccgtagtacacaagaatctcaa
gaaggattaggccctacacaacctaatagaccaaagggtctattcgattga

DBGET integrated database retrieval system