KEGG   Aspergillus flavus: AFLA_120760Help
Entry
AFLA_120760       CDS       T01090                                 

Definition
(RefSeq) fatty acid oxygenase, putative
  KO
K17862  linoleate 10R-lipoxygenase [EC:1.13.11.62]
Organism
afv  Aspergillus flavus
Pathway
afv00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    AFLA_120760
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.62  linoleate 10R-lipoxygenase
     AFLA_120760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 7908968
NCBI-ProteinID: XP_002384783
UniProt: B8NWN9
LinkDB All DBs
Position
Unknown
AA seq 1138 aa AA seqDB search
MKGVPSSAEASNSSPGSSLPSQRAHEPLTHKQPTLDHPRKQSVQSISSEHGGMAENFSKI
TKVVQAARRPLPTETGDGTYIEPENGGSLWRDLRALGIKDANTLKDLIENKAGGLVKGSG
QVVDDKTMLMERIIQLVAKLPTESRNRVKLTNMFLGELWDSLPHPPLSYVGDKYAYRSAD
GSYNNPTLPWLGAANTEYARTIEPLKVRPASLPDPGLVFDSLFARDTFNPHPNNVSSVFF
TWASLIIHDIFQTGHPDENFNKTSSYLDLSILYGDNQEEQNMMRTFKDGKIKPDSFSEPR
LHALPAACGVILVMLNRFHNHVVEQLAAINENGRFTKPPERILDPVEARAAWAKYDNDLF
QTGRLITCGLYINITLYDYLRTIVNLNRDNTTWTLDPRAHMEHDTVPTALGNQCSVEFNL
AYRWHSTISRKDEAWTEQAYQAIVGKPGSEATVEDLMSGMRRLGANMPKDPSKREFAGLK
RQSSGKFKDEELVDILTMAIDEVAGSFGARNVPKVLRSVEILGMEQARRWNVGSLNEFRK
FFDLKPYQSFEEINSDPEVADQLRHLYEHPDNVELYPGIVAEEAKKPMIPGVGIAPGYTV
SRAVLSDAVALVRGDRFYTEYNSRNLTNWGYEEANYDLEINQGCVFYKLALRAFPQYFKQ
NSIFAHYPMTTPSANRDIMKMLGREEDFSWDRPSYTPPRTTLFDYANVRRILEDSSNFRV
IWDEATGYVFGKGGYDFMLSGDSPFHANQRRIMKESLYRSQWHEAVKEFYLEITEQLLSE
KSCRVGNVNQIDISRDVGNLAHVHFASNIFSLPLKTKEHPHGVLTEHEMFDVMSIIFTAI
FFDVDPSKSFRLRHMARKAAETLGPLVEANVKAVSSASFLSTLIDGIRTNKNALSGYGVH
MIRRLLDHGLDASEVTWSQILPTAVAMVPNQAQVFTQIIDYYLSDEGKEHLLNIQQLAKE
DTPASDEMLLRYVMEAIRLNGIFGSYRKSHTNLTLDDKNKMVQIKPGDTVFVSFVDANRD
PNVFPNPKKVDLNRPMESYIHYGVGPHTCLGGEASKVALTAMLRVVGRLKNLRRAPGPQG
ELKKIPRDHGFYTYMRADETSLYAFPMTWKLHYDGTIPGRERSVPEKLTCNVPGHWHD
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggtaccaagctccgccgaggcttccaatagcagtccagggtcttcgctgccc
tcccaacgagcccatgagcccctcactcataagcaaccaactctggatcaccctagaaag
caatcggtgcagtccatcagcagtgagcatggtggaatggctgagaactttagtaaaatt
accaaagtggtccaagctgcccgtcgccccttacccacagagactggagacggaacctac
atcgaaccggagaacggcggaagtttgtggagagatctccgcgccttgggaattaaagat
gcaaatacgttgaaggatctaatcgaaaacaaagccggtgggcttgtgaagggcagtggc
caggtggtagacgacaagacgatgctgatggaacgcatcatccagcttgttgcaaaactg
cccactgaatctaggaaccgtgtcaaacttacgaacatgtttttgggggaactatgggac
tcgctgcctcatcctcctctctcatatgtaggcgataaatatgcctatcgatcagctgac
ggatcctacaataacccaaccttgccctggttaggcgctgcgaatacggaatatgctcgg
acgatcgagccgttgaaggtcagaccggccagtttgccagatcccggcttggtctttgac
agtctattcgcacgagacacattcaatccccaccccaataatgtctcaagcgtcttcttc
acttgggcgtcattaattattcatgacattttccaaacgggacatccagacgagaacttc
aacaagacatcttcgtacttagatctttccatcctctatggcgataaccaagaagagcag
aacatgatgcgcacgttcaaagatggaaagatcaagccagattccttttccgaaccacga
ctacatgcgctacctgcggcctgcggcgtcatcctagtgatgctaaacaggtttcacaac
catgtagtcgagcagctagctgctatcaatgagaatggtagatttaccaagccgccagag
cgtatcctcgatccagtggaagcaagagccgcctgggcaaagtacgataatgaccttttc
cagacgggccgccttattacctgcggtctgtacattaacatcaccctgtacgactatcta
cgcaccatcgtgaacctgaaccgcgataacactacctggacattggatccacgtgcgcac
atggaacacgatacagttcccacggctttgggcaaccagtgttcagtagagtttaatcta
gcttatagatggcactcaacaattagtcgcaaggatgaggcatggaccgaacaggcatac
caggcaattgtcggtaagcccggaagcgaagccactgtggaggacttgatgagtggcatg
agaaggctcggtgcgaatatgccgaaagacccatccaagcgcgagttcgctggattgaag
cggcagtccagtggcaagttcaaggacgaagagttagtggacatcttgactatggccatt
gacgaagtggccggttccttcggggcccgcaacgtccctaaggttttgcgatcggtagaa
atcctaggcatggagcaggcgcgtaggtggaatgttgggtcattgaacgagttccggaag
ttctttgatctgaagccctaccaaagtttcgaagagatcaattccgaccctgaggtggcg
gaccagttgcgacatctctatgagcatccagataacgtcgaactgtacccgggaatcgtc
gccgaggaggctaaaaagccgatgataccaggtgttggcattgctccaggatacaccgtc
tcccgggcagtgttgtccgatgcggtggcgttggttcgaggtgaccgattctacacggaa
tataactcaaggaacctcactaactggggatacgaggaggcaaattacgacttggagatc
aatcaggggtgtgtgttctataaactggcattgagggcattcccccagtatttcaaacag
aactccatattcgctcactatcctatgacaaccccatctgcgaatcgcgacatcatgaaa
atgctcgggcgagaagaagacttctcgtgggaccgtccgtcatatacacctccccgtacg
accctctttgactacgcgaatgtccgccgcatccttgaggattcatcgaatttccgcgtg
atttgggatgaagcaactgggtacgtctttggcaagggtggctatgatttcatgctgtca
ggcgactcgccgttccacgcaaatcagcggcggattatgaaggaatcgttgtatcggtca
caatggcatgaggctgtcaaagagttctatctagagatcaccgagcagctcttgtcagag
aaatcatgcagggtgggcaacgtcaaccagattgacattagtcgcgatgtcgggaatctc
gcccacgttcactttgcctctaacatattttcactccccctgaaaaccaaggaacacccg
cacggagttctcacggagcacgaaatgttcgacgttatgtctatcatctttaccgccatc
ttcttcgacgtagatccatccaaatcattcagactgcgccacatggctcgcaaggcagcg
gagacacttgggccactcgtcgaagccaatgtcaaagctgtgagctccgccagtttcctt
tccactctcatcgatggtatccgcaccaataagaatgcgctttccggttacggagttcat
atgataagaaggctgctcgaccacggtttggatgcctctgaagtcacctggtcccaaatc
ctgcccacggccgttgcgatggtgccgaatcaagcccaagtgtttacgcaaatcatcgac
tactacctttccgatgaggggaaagagcatctactcaatatccagcaacttgctaaagag
gacacgccggcctctgatgaaatgctcctgcgctatgtcatggaggcaattcgcctgaac
ggcatctttggctcctaccgaaagtctcataccaacctaaccctcgacgataagaataaa
atggtccagatcaagcctggagataccgtttttgttagctttgtcgatgccaaccgcgac
cctaacgtcttcccaaatcccaagaaggtggaccttaaccgtcccatggaatcatatatc
cattatggcgtcggtccacatacctgtctgggcggcgaggcaagtaaagtcgctctaacg
gccatgttgcgtgtggttggccggctgaaaaatctccgccgtgctccgggaccgcagggt
gaattgaagaagatcccgcgagaccatggtttctacacatatatgcgggcagacgagacg
agtctctatgcgttccctatgacttggaagctccactacgatggtacaattccgggaagg
gagcgatctgtcccggaaaagcttacgtgcaatgttcctggacattggcatgattga

DBGET integrated database retrieval system