KEGG   Aspergillus niger: ANI_1_1118024Help
Entry
ANI_1_1118024     CDS       T01030                                 

Gene name
An02g07930
Definition
(RefSeq) fatty acid oxygenase
  KO
K17862  linoleate 10R-lipoxygenase [EC:1.13.11.62]
Organism
ang  Aspergillus niger
Pathway
ang00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    ANI_1_1118024 (An02g07930)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.62  linoleate 10R-lipoxygenase
     ANI_1_1118024 (An02g07930)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450 YrzO
Motif
Other DBs
NCBI-GeneID: 4979282
NCBI-ProteinID: XP_001399926
UniProt: A2QDQ5
LinkDB All DBs
AA seq 1110 aa AA seqDB search
MLRRFSSTFKRSSKGDRDSKPNGTQVNGQKRQSKVPAPRKSSSDESHSDHGVESDDGVSV
FEKYAQVLHASRRPLPNQNGDGTYLEQEHSGSLFKDLRALGFKDIGTLKDLIKTKAKGEY
IDDKTMLMERIIQLVSSLPGNSKTRVDLTNAFLDELWGSLPHPPLSYMGEEYAYRSADGS
NNNPTLPWLGAAGTPYARSIAPLTIQPGGLPDAGLVFDCLFAREKFTPHPNKVSSLFFDW
ASLVIHDIFQTDYTNSHVNKTSAYLDLSILYGDDQEDQNLVRTFKDGKLKPDTFSEQRLQ
AFPPACSVLMVMLSRFHNWVVEELAAINENGRFNKPDPRLDEEKARKAWEKYDNDLFQTG
RLVTCGLFINITLYDYLRTIVNLNRSNSTWCLDPRVQMEGTKSTPSGLGNQCSVEFNLAY
RWHSAISANDEKWTEEIYEELMGKPASEVSMRELLVGLGKYEREIPKDPSKRTFAGLKRQ
EDGTFKDEDLVRILANAIEDVASSFGARNVPKVLRSVEILGIEQGRKWNVGSLNEFRKFF
DLKPYETFEEINSDPDVADSLRHLYEHPDYVELYPGIVAEEAKEPMIPGVGIAPTYTISR
AVLSDAVALVRGDRYYTIDYNPRNLTNWGYNEVRYDLNINQGCVFYKLAMRAFPNYFKPD
SIYAHYPMTIPSENRNIMKNLGRESHYSYDRPRYTEPVPNLLSYANAKLVLNNQKDFTVP
WGGLSSIHAGKGGADFWSKSFDNEQWRNSVKEFYEDATLKLLNEKSCKLAGNKQVDIARD
VGNLVPVHFVSKVFSLPLKTKSNPRGIFTEHEMFMIMAVVFNSTFFDVDPTKSFPLQHAA
RAVSQELGKVVEAHVKSINHPGFLHGIIDSFRDDHNALKDYGDQLIKRLLESGLGVSDVT
WGQILPAAVEMVHTQSQMFTQIIHFYLTEGQKYLPEINRLANENTAEANDRLTRFCLEAV
RLNGNLGIYREAQADINVSDETGQYSVKSGEKVFVGSSKANRDPQAFPSPDEVRLDRPLD
SYLHYGLGPQSGLGKDATLAAVTAMVRVVARLDTLRPAPGAQGQLKKIPQEAGFSVYMRE
DYGSYSPFPTTYKVHYNGDVPAPKRQVTTA
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccgattctcttcgacattcaagagatcgtcgaaaggcgatcgcgattcgaaa
ccgaatggcacacaggtgaacggccagaagcgccagtcgaaagtgccggcgccgcgcaaa
tcctcctcagatgagagccacagcgatcacggtgtggaaagcgatgacggcgtgtccgtc
tttgagaaatatgcccaggtcttgcatgcgtcccggcgcccactaccgaaccagaacggc
gatggcacctatctcgagcaagagcactcggggagcttgttcaaggacctgcgcgccttg
ggcttcaaggacatcggaaccctgaaggatctaatcaaaacgaaggccaagggagaatac
attgatgacaagaccatgctcatggagcggattattcagcttgtcagcagtctcccagga
aactcgaaaacccgcgtcgacctcaccaacgccttcttggatgaactgtggggttccttg
cctcaccctcctctgtcttacatgggagaggaatatgcctaccggtcagcagatggttcc
aacaacaatcctacacttccctggctaggcgctgcggggacaccttacgctcgctcaatc
gctcctctgactattcagcccggcggtttgcccgatgccggtcttgtctttgactgtctt
ttcgcgcgcgagaagtttacccctcaccctaacaaggtgtcgagtcttttcttcgactgg
gcatccctcgtcattcatgacattttccagactgattacacaaattctcacgtcaacaag
acctcagcctatctcgatctttcgatcctgtacggcgatgatcaggaagaccagaacttg
gttcgtactttcaaggacggcaaactgaagcctgataccttttcggaacagcggctccag
gctttcccgccggcctgctccgtgttgatggtcatgctaagcagattccacaattgggtc
gtggaggagctggcagcgatcaatgaaaacggtcgcttcaacaagcccgatcctcgtctc
gacgaagagaaagctaggaaggcctgggaaaagtatgacaacgatcttttccagaccgga
cgactggtaacatgcggtctgttcatcaacatcacgctatacgattatctgcgcaccatt
gtcaacctgaaccgcagcaacagcacatggtgtctggatcccagagttcagatggagggc
accaagagtaccccatcgggtctcggtaaccagtgctccgtcgaattcaacctcgcgtat
cgctggcattctgctattagtgccaatgatgaaaagtggactgaagagatctacgaagag
ctgatgggcaagcctgcctcggaggtctccatgcgtgagcttctcgttggacttggcaag
tatgagagagagatcccgaaagacccgtcaaagcgcacatttgccggtctgaagcgacag
gaagatggaacattcaaggacgaggatctcgttagaatcctggccaatgcgattgaggat
gttgccagctccttcggtgcacggaatgtgcccaaggtcttgagatctgtggaaattctt
ggtattgagcagggtcgcaagtggaacgtcggctctctgaacgaattccgcaagttcttc
gatctcaagccatacgaaacgttcgaagagatcaactctgacccggatgtcgctgactcc
ttgcgtcacctgtacgagcacccagactatgtggaactctaccctggtattgtcgccgag
gaagcgaaggagcctatgatccctggtgttggtattgcacctacctacaccatctcccgc
gcagttctctccgatgctgtggctctcgtccgtggtgacagatactataccatcgactac
aacccacgtaaccttacgaactggggatacaatgaggtccgctacgatctcaacatcaac
cagggatgtgtgttctacaagctcgccatgcgggccttccccaactacttcaagcctgac
tccatctacgcacactacccaatgaccatccccagcgagaacaggaatatcatgaagaac
ctcggtcgcgagtcccactattcgtatgacagaccccgttacacggagcctgttccgaac
ctgttgtcctacgccaacgccaaattagtcttgaacaaccagaaagacttcactgtgcct
tggggtggactcagctcgatccatgccggaaagggaggcgctgacttctggagcaagtca
ttcgataatgagcagtggagaaatagcgtgaaggaattctacgaggatgctaccctgaag
ctactcaacgagaagtcttgcaaacttgctggcaacaagcaggttgacattgcaagggac
gtcggaaacctcgtgcctgtgcatttcgtctccaaggtcttctcgctgcccctgaagacg
aagagcaatccccgcgggatctttaccgaacatgagatgttcatgatcatggcggtggtc
ttcaattccaccttcttcgatgttgaccctaccaagtccttcccgctccagcatgcagcc
cgcgcggtttcccaggagctgggtaaggttgtggaagcccatgtcaagtccatcaaccac
cctggcttccttcatggtatcatcgatagcttccgcgacgaccacaatgccttgaaagac
tacggagatcagctgatcaagcgccttttggaaagtggtctgggagtctccgatgtgacc
tggggccagatcttgccggcagctgtcgagatggttcacactcagtcgcaaatgttcacc
cagatcatccacttctaccttaccgaaggtcagaagtatctcccggaaatcaaccgcctg
gccaacgagaacactgcggaggctaatgacaggctcacccgcttttgcctggaggctgtc
cgcctgaacggcaacctgggcatctaccgcgaggcccaggccgatatcaacgtgtctgat
gagaccggccaatacagcgtcaaatcgggagagaaggtgtttgtcggctcgtcgaaggca
aaccgtgaccctcaggccttcccatcgcctgacgaggttcgccttgaccgccctctcgac
tcctacctacactatggtcttggcccccagagtggtctgggtaaggatgccaccctcgcc
gcggtgaccgccatggtgcgggttgtcgcccgcctggacactctccgccctgctcctggc
gctcaaggacagttgaagaagattccccaggaagctgggttctccgtatacatgcgggag
gactacggcagctactctccgttcccgactacctacaaagtccactacaacggcgatgtg
ccggcgcctaagcgacaggtcacgactgcttga

DBGET integrated database retrieval system