KEGG   Aspergillus niger: ANI_1_1828074Help
Entry
ANI_1_1828074     CDS       T01030                                 

Gene name
An08g03380
Definition
(RefSeq) histone-lysine n-methyltransferase, suv9
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ang  Aspergillus niger
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ANI_1_1828074 (An08g03380)
Enzymes [BR:ang01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ANI_1_1828074 (An08g03380)
Chromosome [BR:ang03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     ANI_1_1828074 (An08g03380)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    ANI_1_1828074 (An08g03380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 564 aa AA seqDB search
MVIDLTVDSDSEERNENHVPSSAPPLQNNTPKSPSTLTHRPASSVPLKRKSEDAEELLAS
FLPRRPQSQPRSFSQPQSANRANQHAISIEIEDDDDDDEDVKPVQIRRRVTAARTSSFNP
NAISASKENRPLQIKSNATSTRSSSPFNLTTTNHDHRRSQDRDEDRKQRSLLSTRRSISF
QTPSPGPISLSVVIPSPSRRQQQELDSAEVISVPSPIGLSENFYPTDAYEKRALKGAYPV
ARKVNRAAIPFTIGAPGPLLTSKPDISAQLHQTLQQKLAKIRGPKVTFASGDQHQLAQFA
ANFEFVNAYKLRQGVTPVPEEFLAGCSCDGFCDPARCLCLSKEEETNDPMVPYKRADDDG
RLLVLTPEFLKRKAMIYECSSRCGCDERCWNRVVQNGRTVRLEIFQTGNRGFGLRSPDHI
RAGQFIDCYLGEVITKEVADIREDVATSQNRHSYLFSLDFLATGEDSKYVVDGHKFGGPT
RFMNHSCNPNCRMITVTRNHADDYLYDLAFFAFKDVPPMTELTFDYNPGWEKVKKVDPNA
VPCLCGESNCRGQLWPNQRKAKRG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcgatcttacggtcgactcagactcagaggagagaaatgagaatcatgtgcca
tcttcagcaccacctcttcagaacaacacccccaagtctccttccactctcacccaccgc
cctgcgtcctcagttcccttgaaaaggaaatctgaagatgcagaggaactgctggcatcc
ttcctgccccgccggccgcaatcacagccgcggtctttttcccaaccacagtcggcaaac
cgcgccaatcagcacgccatctctatcgaaatagaggatgacgatgatgatgacgaggat
gtcaagcctgttcagattcggcgcagagttacagctgctcgaacctcctcctttaatcct
aacgccatctctgctagtaaggaaaacagacctctgcagatcaagtctaatgcaacatct
actcgctcatcgtcacccttcaatctcacgaccaccaatcacgatcaccgccgcagccaa
gaccgggatgaagacagaaagcagagatccctcttaagcacccgtcggtccatatcattt
caaacccccagtcccggccctatctctctcagcgtagtaattccctcgccttctcggcgc
cagcaacaagaactcgattcagccgaagtgatctccgtcccttctccaattggcctctcc
gagaacttctatccaaccgacgcatatgagaaacgcgccttgaaaggcgcataccctgtg
gcccgaaaagtcaatcgagcagccatcccattcactatcggcgcccctggcccgctgttg
acttctaagccggatatcagcgcacagctgcaccaaaccctgcagcagaagctcgcaaag
atccgaggccccaaagtaacctttgcatctggggaccagcaccagctagcgcagttcgca
gccaactttgagttcgttaatgcatacaagctacgacaaggggtcacgcctgttccagag
gagttccttgcgggatgtagctgtgacggattctgcgatccagcaagatgtctttgtctc
agcaaagaagaggagaccaatgacccaatggtgccgtataagcgggctgacgatgatggg
cgattgttggttctcaccccggagttcctaaaacgaaaagccatgatctacgagtgtagt
tcgagatgtggatgtgatgagcggtgctggaatcgggtggtgcagaatggccggacggta
cggctagagattttccagaccggtaatcgagggttcggcctccgctcccccgaccacatt
cgcgcaggtcaattcatcgactgctacctcggggaggtcatcaccaaagaagtggccgac
atccgcgaagacgtcgcgacatctcaaaacagacactcgtatctattcagtctcgacttt
ctcgccaccggcgaagacagcaaatacgtagtagacggacacaaattcggtggtccaacg
cgattcatgaatcactcatgcaaccctaactgtcgcatgattaccgtgacccgcaaccac
gctgacgattacctgtacgacttggctttcttcgcttttaaagatgtgccgcctatgacg
gaactgacatttgattataatcccggctgggagaaagtcaagaaagttgatccgaatgcc
gttccttgcctctgtggggagagtaattgtcgaggtcagctgtggccgaatcagaggaag
gcgaagagggggtga

DBGET integrated database retrieval system