KEGG   Aspergillus nidulans: AN0097.2Help
Entry
AN0097.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
ani  Aspergillus nidulans
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AN0097.2
Enzymes [BR:ani01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AN0097.2
DNA repair and recombination proteins [BR:ani03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AN0097.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
VIII
AA seq 1009 aa AA seqDB search
METDQDMHDQAMAGEETDLDEKYPNRPQNKAPTLPFHDLYETLFRPLREIKKKPVGPAGN
RRKAGPHGLSAANLNPIERRRDIIERFISRWRKEVGDDIYPAFRLILPDKDRDRAMYGMK
EKIIGKMLVNIMKIDKNSEDGFNLLNWKLPGQSATSSMAGDFAGRCYDVVSKRPMRTEFG
NMLIEEVNEKLDQLSSASKEEEQLPILAEFYRRMNPEELAWLIRIILRQMKLGATERTFF
DVWHPDAENLYSISSSLRRVCWELHDPNIRLDAEDRGVSLMQCFQPQLAQFQMQSLDRMI
ARMRPTEDDPVFWIEEKLDGERMQLHMVSDASAPGGRRFRFWSRKAKDYTYLYGNGIYDE
AGSLTRHLKDAFADGVDNLILDGEMITWNTEQDAPEPFGTLKTAALSEQRNPFRQGIHPL
FRVFDILYLNGRDLTRYTLRDRRNALQKVIKPVHRRFEVHSYEEATTKAEVEASLRKAVA
EASEGLVLKNPRSPYRLNERHDDWMKVKPEYMTEFGESLDLVVIGGYYGSGHRGGKLSSF
LCGLRVDEGQSSQGSNPTKCYSFCKVGGGFTAADYANIRHHTDGKWVEWNPKKPPTTYIE
LAGGDSQYERPDMWIKPEDSVVICVKAASVSVSDQFRIGLTLRFPRFKRLRMDKDWKSAL
SVQEFLDLKSHAEQEHREKEFNVENFRKKRVKKTTKKPLAIAGYDENAEVQYAGPSGHIF
DGLNFFILTDSNAPVKKSKAELENLVKANGGRIFQTNDAVPDTICIADRRTVKAASLQKK
GDIDIIRPSWILDCIKQSEIDAGLPDLLLPLEPGHMFFMTKDKEEIVAGSLDQFNDSYAR
DITVEELRNLLDQMAKDGKTDSFCSPEAIQKVTEHIQEKVDSGWTMPCGWLFKGLVLCFP
ENENDSASEGPEPKQSQRIHLAQNTAKFAGASVTTSLKDTSITHVVVDPDFTSSELPKLR
RTLSTRRKLPHIVKVNWIEDSWKENTLLDEEQHMPVYMRRYPNIQLMKV
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaccaggacatgcatgatcaagccatggctggggaagagacagacctcgat
gaaaagtaccccaatcgcccccaaaacaaagctccgaccctgccgttccacgatctctac
gaaacgcttttccgtccgctcagggagataaagaagaagcccgttggaccagcaggaaac
aggagaaaggccggaccacatggcctgtcagctgcgaacctgaatcctatcgaaaggcga
cgcgatataatagagcgcttcatttcaagatggaggaaagaggtcggcgatgacatatat
ccagcgttccgcttaattctcccggacaaagatcgagatcgggcaatgtatggaatgaaa
gagaagataatagggaaaatgctggtcaatattatgaagatcgacaaaaactccgaagac
ggtttcaatctcttgaactggaaactccccggtcaatctgctacctcgagcatggcaggc
gactttgcgggcagatgttacgatgtcgtctcgaagcggccgatgcgcacggaattcggg
aatatgctgattgaagaggttaatgagaagcttgaccaactgtcgagtgcgtccaaagag
gaggagcagttacccattcttgcggaattctaccggcgcatgaaccccgaagagctagca
tggttgatcaggatcattctccggcaaatgaagcttggggcgacggagcggacctttttc
gatgtctggcatccagatgcggaaaatctatacagcatctcgagtagtcttcgtcgtgtc
tgttgggagctacatgatcccaatatccgactcgacgcggaggatcgaggcgtgtcgctg
atgcaatgcttccaaccgcaacttgctcagttccagatgcagtcactagatcgtatgata
gctcgcatgaggccaactgaggacgatcctgttttctggattgaagaaaagctcgatgga
gagcgtatgcagttgcatatggtgtcggatgcttctgcgccagggggtagaaggtttcga
ttttggtcgaggaaggccaaagactatacatatctgtacggaaacggtatatacgacgag
gctggatctttgacccgtcaccttaaagatgcgtttgcagacggagtagataacctcata
ttggatggagagatgattacgtggaataccgaacaagatgcacctgagccctttggtaca
cttaagacggctgctttatccgaacagagaaacccttttcgacaaggtattcatccacta
ttcagagtctttgacattctttatctcaacggccgagacctgacacggtacacactccga
gatcgtcgaaatgccctgcagaaagtcataaagcccgtacatcgccgcttcgaagtgcac
tcctatgaagaggctacaaccaaagctgaggttgaagcttctctcagaaaggcagttgca
gaagcttctgagggcttggtcctgaagaatcctaggtcgccataccgactgaacgaacgg
catgatgactggatgaaggtgaagcccgagtacatgactgaatttggggaatctcttgac
cttgtcgtgattgggggctactatgggtctggacaccgcggcggcaaactctccagcttt
ctatgtggtttgagggttgacgaaggacaatcttctcaaggctcaaatcctaccaagtgc
tactctttctgcaaagttggcgggggcttcacagccgctgattatgcgaatatcaggcat
cacactgacggcaagtgggtggagtggaatcccaagaagcctcccacgacgtacatcgag
cttgcaggtggtgactcccagtatgagcggccggatatgtggattaagccggaggactcg
gtagttatctgcgtaaaagcagcgtctgtgtcagtcagcgatcaatttcgaataggcttg
acgcttcggtttccccggtttaagcggctacgcatggataaagactggaaaagcgctctg
tctgtgcaggagttcctagatctcaagtcccatgccgaacaggaacatcgagagaaagag
ttcaatgtcgaaaatttccgcaagaagcgcgtcaagaaaacgacaaaaaaaccgcttgcg
atagcaggatatgacgaaaacgctgaagtccaatacgccggtccatcgggacatatattc
gatggactcaatttcttcatcttgaccgactcgaacgcgcccgtaaagaagtcaaaggct
gagctggagaatttggttaaagccaacgggggcagaatctttcagacgaatgatgctgta
cctgatacaatctgcatcgcagataggagaacggtaaaggcagcatctttgcaaaagaag
ggggatatcgatattattaggccgtcctggattctcgactgtatcaaacagagcgagatc
gacgcgggactcccagacttacttcttcctcttgagcctgggcatatgttttttatgacc
aaagacaaggaagagatcgtcgcaggtagcctggatcagttcaacgatagctatgcccga
gatattactgtcgaggaactgcgaaacctcctggatcagatggcaaaagatggaaaaacc
gacagcttctgcagtcctgaagccatacagaaggtcacagaacacatccaagagaaggtg
gactccgggtggacaatgccatgcggttggctgttcaaaggactggtcctttgtttcccc
gagaacgaaaacgattcggcttcagaaggccctgagccgaagcaatcacaacgaatccat
ctagcccagaacacggccaaattcgcaggcgccagcgttacaacctcattaaaggataca
tctattactcatgtggtcgtggacccggacttcacatcgtctgaattacccaaactccgc
agaacactctcaacgcggaggaagctaccgcatatcgtcaaggtaaattggattgaagac
agttggaaagagaatactcttttggatgaagagcagcacatgccagtttacatgcgcaga
taccccaacattcaactcatgaaggtctga

DBGET integrated database retrieval system