KEGG   Aspergillus nidulans: AN1923.2Help
Entry
AN1923.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
ani  Aspergillus nidulans
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AN1923.2
   00220 Arginine biosynthesis
    AN1923.2
Enzymes [BR:ani01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AN1923.2
Amino acid related enzymes [BR:ani01007]
 Aminotransferase (transaminase)
  Class I
   AN1923.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
VII
AA seq 499 aa AA seqDB search
MTTRTTVPNASQRALSTAAVRCLTLDNINSNVKAAKYAVRGELAVKAEEYRVRLAQGDKT
LPFDSVIFANIGNPQQLDQKPITFFRQVLSLMENPLLLSNKDALRTSFGYQDDVIERAEK
LLAEVQSVGAYSHSQGAPLIRESVAKFIEERDGFPADPQSLYLTGGASSGVNTILNVICN
GPNAGVLVPIPQYPLYTATLSLLNAQCVPYHLEEQKAWGTDIGTIKKSLEQAKAAGTDVR
AIVVINPGNPTGASLSPADIKSVLDIAAEEKLVVIADEVYQTNVFIGEFTSFKKRLRELQ
QEVPGKYDNVELVSLHSTSKGMVGECGHRGGYFELVGFDPLVAAQVYKFISIMLCPPVIG
QCLVELMVNPPKEGEPSHELYQKEYNGIREGLRQRAFALYEAFQRMEGVECQEPQGAMYL
FPTISLPPKAIEAAAAENRAADEFYCLRLLDATGVCVVPGSGFGQKENTLHFRTTFLAPG
TDWVERIVKFHSEFMAKYK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgaacgacagttcctaatgcctcgcaacgcgctctatccactgcggctgtt
cgttgcctgaccctagacaacatcaattcgaacgtcaaggctgccaagtatgctgttcgt
ggagaactcgccgttaaggcggaggaataccgtgtgaggctggctcagggagacaagaca
ctgccgtttgacagcgttattttcgccaacatcggcaatcctcagcagctcgaccaaaag
cccatcactttcttccgtcaagtcctcagtcttatggaaaaccctctactgttaagcaac
aaagatgcccttcgtacgtctttcggctatcaggatgatgttatcgagcgggccgagaag
cttctggccgaagtccagagtgttggtgcatacagtcacagccaaggtgctcccctgatt
cgcgagagtgtggccaagttcattgaagaacgtgatggcttccccgccgaccctcagtcg
ctttaccttactggtggtgcctcttccggtgtaaacaccattctgaacgtcatttgtaat
gggccaaatgctggtgtcctagttccgattccccagtatcctctgtacacagccacttta
tccctcttgaatgctcagtgtgttccttaccacttagaagagcagaaggcttggggtacc
gacatcggtacaatcaagaagtcattggaacaggccaaggctgcaggcactgacgttcgc
gccattgttgttatcaaccctggcaacccgacgggcgcttctttgagtccagctgatatc
aagagcgtccttgacatcgccgcggaagagaagctcgtcgtaattgcggacgaggtatac
cagacaaatgtgtttatcggagaattcacatcgttcaaaaagaggctccgggagctgcag
caagaagtacctggtaaatacgacaatgtcgagcttgtttcccttcacagtacttccaag
ggtatggttggtgaatgtggccatcgcggaggttacttcgaactggttggatttgatccc
ttggttgctgcccaggtctacaagttcatcagcatcatgctctgccctcctgtcatcggg
caatgtttggttgaactgatggtgaaccctccaaaggagggcgagcccagccatgagttg
tatcagaaggagtacaacggcatccgggaaggactgcgccagcgcgcctttgccctctat
gaagcttttcaacggatggagggtgtcgagtgccaagagcctcagggtgccatgtacctt
ttccctactatctcactgcctcccaaggctattgaagccgctgccgctgagaaccgcgcc
gcagacgaattctactgcctccgtctccttgacgccactggtgtttgcgtcgtccctggc
tccggcttcggtcagaaggagaacacgctccacttccgcactactttcctcgcaccaggc
acggactgggtggagcgtatcgtgaagttccattccgagttcatggccaaatacaaatag

DBGET integrated database retrieval system