KEGG   Aspergillus nidulans: AN2366.2Help
Entry
AN2366.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     AN2366.2
Peptidases [BR:ani01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   AN2366.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN2366.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
VII
AA seq 249 aa AA seqDB search
MKTAVKTTALLSLLSTAMADKAIVGGDDAEITEYPYQIALLSGGSLICGGSIISSKYVVT
AGHCTDGASASSLSIRAGSTYHDKGGTVVDVEAITVHPEYNANTVDNDISILELAEELQF
GDGIKAIDLPSSSSLPSEGTIGTATGWGALTEGGNVSPNLQYVEVPVVSKSQCSSDYSGF
NEITASMFCAGEEEGGKDGCQGDSGGPFAADGVLIGITSWGNGCARAGYPGVYSSPAYFR
DFIQQVTGL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgccgtcaaaaccaccgcccttctctcccttctctcgaccgcgatggccgac
aaggccatcgttggcggcgacgacgccgagatcaccgaatacccttaccagattgcgctc
ctctctggcggctccctcatctgcggcggctctatcatctcttccaagtacgtcgtgacg
gccggccactgcactgacggcgcgtccgctagctcgctctccatccgcgcgggctccacc
taccatgataagggcggcaccgtcgtcgacgtggaggcgatcaccgtccaccctgaatac
aacgccaacaccgtcgacaacgacatctccatcctcgagctggcagaagagctccagttc
ggcgacggcatcaaggcgatcgatctgccttcctcttcttcgcttccttctgagggcacc
atcggaaccgcgacgggctggggtgcgctgaccgagggcggcaacgtcagccctaacttg
cagtatgtggaggttcccgttgtcagcaagagccagtgctcgagtgactactccggcttc
aacgagatcaccgcgtcgatgttctgcgccggcgaggaggagggcggcaaggatggctgc
cagggcgattccggcggtcctttcgctgcggacggtgtcctgatcggtatcacctcatgg
ggcaatgggtgtgcgcgtgccggataccccggtgtttactcgagcccggcttacttcagg
gacttcatccagcaggttactggtctgtaa

DBGET integrated database retrieval system