KEGG   Aspergillus nidulans: AN4885.2Help
Entry
AN4885.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K14790  nucleolar protein 9
Organism
ani  Aspergillus nidulans
Brite
Ribosome biogenesis [BR:ani03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    AN4885.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC RCC1 RCC1_2 PUF Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 2872681
NCBI-ProteinID: XP_662489
UniProt: Q5B3J5
LinkDB All DBs
Position
III
AA seq 1713 aa AA seqDB search
MGNVLRDLKLGETSGAAIIENGDLVQWGKGYSETEFKPTKTLTGKNLISLSMSHDRIVAL
SSDGKVYSLPVSKHDQTSGKKAEEKSWLPFSSGKSSMSYRLIQPILKLGEKIVAISGGLE
HVLLLTSSGRVFSAVSSTENFPSFGQLGVPGLTWATRPPGPVDAPHEVKTPNGVKVAQIA
TGDYHSLLLTKNGNVLAFGDNSFGQLGLGFDPNSPFLDTPTPILMESLYRDSSRSPRATG
VAAGGANSFFTVDVHQDGQGQGSKSPSKVISDIWTCGRGIWGALGNGKWTHLQDHPTLLK
ALSGLVEYDEATQRLLPIRLNDISVGTTHVAAVLDNQTRLNRSASSLEGADDAGLDVVWW
GGNEHFQLGTGKRSNLSKPAHINVSPETVSLDDKELARLQIMPAYRGIVGDRSVDMRQRV
ECGRHVSAIYTASPTFTSKQAIMPRENQKRGRRATEKAKKEASKRKRDEGIEEPTLKRLK
PSADEDNAVTAGADYVPLEGEEYDDQYATGAADEMPFYGLLDSEEQEYFSRANEMLELNQ
FGDAEERRLFVDSVFREARGKELKIACSQSCSRLMEKLISVSDIHQIWRLFNKFIGHFLT
LVQHRFASHCCERLFISAAPGVTQKASKTKSKKDDDIEMDEDEEPEPELPLAEMFMKVVE
ELQGNWGYLLTERFASHTIRVLLLVLAGEPVDVSSNDSVVASRKKERLGVVGGETQENNP
SGEKRSVPESFEATLKKVMQDMVSVLDDTYLRALATHPVGNPVLQVLVRLELSHFGKSSA
KQPTSIIKRLIPDENFEDDSETTRFIRGLLYDPVGSRLLETMVRCMPGKMFKSLYRNYLR
DQMSSLARNQTAGYVVLRVLERLGRDDLHAVMEQIVPKIPSLIERSRTIVPKVLIERCLA
RGVDTKPIAKALESSYDSDPARRLEQMLRLETAMADNKEKSDKNGPPGESNPGSAAAEKL
HGSLLAQTIVTAPGQLSELVFSSLLALSPEVLLSICKDPTASRVIQQALTSPASSPQFRR
QFTTRFTSHMNELALDSSGSHVVDALWPATKDIYFIKERMAQELAQNELALRDSFVGRAV
WRNWAMDLYKRRRGEWAAKAKGRDITNDSAEKPKSRLDMARASIDPKIQGSNYCCKFLYK
LPVQWRRRHPEVAQTKCEIAVEDLLIPFIRSADEDTLGPEVQQNGVNKSNKTNGDHALVG
TSLVDYKKPEELQDILQLDLPEQGTGQTGLVSVLRKVLRYSVNTWHQGFLDKLYASTNAP
GVASELILAALNTNVHVYQVSPALSVIEKHTGKRLAALFGLNGPRAGGISVQGGSASNTT
SIVIARNNLYPNTKTDGNGDYKFVLFTSAHGHYSIEKAAQMLGLGSSAAWSVPIDKEGRM
IPSELEKLVQKALSENRTPFYVNATAGTTVLGSFDPFDDIAAICKKYNLWLHIDGSWGGS
FAFSRRQRHKLAGAEKANSIAINPHKMLGVPVTCSFLLASDLRQFHRANTLPAGYLFHNN
DDEDAVPVENGIGGFSELNSDSPEIWDLADLTLQCGRRADSLKLFLSWTYYGTAGYERQI
DNACDTAAYLATIIQDHPDFILVSQNPTPCLQVCFYYGPNGKLLHPRGDSIVSDENQRAK
ANSKVTEQITHAIVGRGFMVDYAPPSGDEKAVGDGKFFRCVINVQTTRETVEGLVRAIEE
VGPGVVKGLLSEGASAVKKRPGEQGHGPVVHRV
NT seq 5142 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtactcagggatctcaagctcggagagacgtctggagctgcaattatcgag
aatggtgatttggtgcaatggggcaaaggctactcagaaaccgagttcaaacctaccaag
acccttactggaaagaatttgatttctctgtctatgtctcacgatcgcattgtggcactc
tcatcagacggcaaagtttactcgctcccggtctcgaaacatgaccaaacatccgggaaa
aaggccgaggagaaatcgtggctgcctttctcctccggcaaatctagcatgagctatcgc
ctaatccagccgatcctaaagctgggagagaagatagtagccattagcggtggtctggaa
catgtccttctgctaacaagctcaggacgagtattctccgcagtctcgtcgactgaaaat
ttcccttccttcggacaactgggtgtccccgggctgacctgggcgactaggccaccaggg
ccagtggatgctcctcacgaggtcaagacgcctaacggcgtaaaggtcgcgcaaatcgcg
acaggcgattaccactcattgttgcttaccaagaatggcaacgttttggcgtttggcgac
aactcgtttgggcaactggggttgggatttgacccgaattctcctttcttggacacgccc
actcctatacttatggagagtctttaccgcgacagctcacgctctcctagggcaactggc
gttgcggccggaggcgcaaacagcttctttaccgtggacgtacaccaagatggccaaggt
caaggttccaaatcaccaagtaaggtcatatctgatatctggacctgtggacggggaatc
tggggtgctctcggaaatggcaaatggactcacttgcaggaccatcccactctattgaag
gctctcagcgggctagttgaatacgacgaagccacacagaggctattgccaatccgcttg
aatgatatctctgtcggtacaacacatgtcgcagctgttctcgacaaccaaacgcgtcta
aatcgttccgcgtcttctctggagggggccgacgacgcaggtctcgatgtggtctggtgg
ggcggaaatgagcacttccaacttgggactggcaagagaagcaatctttctaaaccagcg
catatcaatgtgtctccggaaaccgtatcccttgatgacaaagagctcgcgcgactccag
attatgcctgcttatcgtggaatagttggtgaccggagtgttgacatgcgacagcgcgtt
gagtgcgggagacatgtgtctgcaatttacactgcttctccaactttcacttcaaagcaa
gccatcatgcctcgcgaaaaccaaaaacgaggtcgtcgggcgaccgaaaaagccaaaaag
gaagcatccaaacggaagcgcgacgaaggaattgaagaaccaacgcttaagcgattaaag
ccctcagcggacgaggacaacgcagtcaccgccggcgcagactacgtacctctcgaagga
gaggaatacgatgaccaatatgcgacgggagcggcagatgaaatgcctttctacggtctg
cttgactccgaagaacaggaatatttcagcagagcgaatgagatgctagagctgaaccaa
ttcggggacgccgaggagcgcagattatttgtagacagtgtgtttcgggaggctaggggg
aaggaattgaaaatcgcttgcagtcagtcgtgctcgcgactcatggagaagttgatatca
gtttcggatattcatcagatctggaggttgtttaacaagttcattggacatttcttgacg
ctcgtacagcatcggtttgcgagtcattgttgcgagagattgttcatcagcgcggcacca
ggtgtgacgcagaaggcgtcgaaaacaaagtcaaaaaaagacgatgatatcgagatggat
gaagatgaagagccggagccggagctgccactggcggagatgtttatgaaggtcgtcgag
gagctgcagggaaactggggatatttgttgacggaacgattcgcgtcccatacaattcgg
gtgttgcttcttgtgcttgccggagaacctgtcgacgtgtcttccaacgattcggttgta
gcgagtcgcaagaaggagagactgggagttgtcggtggggagacacaggagaacaatcct
tcaggagagaagaggagtgttccggagtcgtttgaggctacgctgaagaaggtcatgcag
gacatggtctccgtactcgacgatacgtatttacgagctcttgcaacgcaccctgtcggg
aacccggttctacaggtgctggttcggctagagctttctcactttgggaagtcaagcgcg
aagcaacccacgtcaatcatcaagaggctgattcctgatgagaattttgaagatgattcc
gagactacgagatttattcgcggcctgctctacgatcctgtgggttcacgtctcctagaa
acaatggtacgatgtatgccagggaagatgttcaagtcgctctacagaaattacctccgc
gaccagatgagctctcttgctcgtaaccagaccgccggctacgtcgtgcttagggtcctt
gaacgtttaggaagagatgacttgcatgctgtgatggaacagattgtacccaagataccc
agccttatagaacgctctcggacaatcgtgccaaaagtgttgatcgagagatgtttagcc
cgaggagttgatacaaagccaattgcaaaagctctcgaatcttcatacgactcggatcct
gctcgcagactcgaacagatgctccgacttgagacggcgatggccgataataaagaaaag
tccgacaagaacggcccgccaggtgaatccaacccgggctctgctgctgccgaaaaactg
cacggctcattgctcgcacaaaccatcgtcacagctccggggcaactgagcgagctcgta
ttctcaagtctgctcgcactgtctcccgaagtccttctcagtatctgcaaagacccaacg
gcgtcgcgcgtaatacaacaagccctaacatcgcccgcctcttctccacagttccgccga
caattcactacccgctttacgagtcatatgaacgagcttgcgcttgatagtagtggatcc
catgtggttgatgctttgtggccagcaaccaaggatatctactttatcaaggaacggatg
gcgcaagagctagcccagaacgaactagctctccgcgactccttcgtcggacgtgcggta
tggaggaactgggcgatggacctttacaagagacgccggggcgaatgggcggccaaggcg
aagggaagagatattacgaacgattctgctgagaaacccaaatcgcgcctcgatatggct
cgcgccagtatagatccgaagatacaaggcagcaactattgctgcaagtttttatataaa
ctacccgttcaatggcgacgccgtcacccagaagtcgcgcagacgaagtgcgaaattgca
gtcgaagatcttctaatcccctttattagatccgcagacgaggatacccttggtccagaa
gtgcagcaaaatggcgttaacaagagcaacaaaaccaacggagaccatgcgctagtcggc
acatcgttagttgactataagaaaccagaagaactgcaggacatcctgcagttggatctc
ccggagcaaggcaccggccaaaccggcctggtcagtgtccttcgcaaggtgctccgctac
tccgtcaatacctggcaccaaggcttcctagacaagctgtatgcgtcgaccaatgcgcct
ggagttgcatcagagctcatactcgcagcgctgaacacaaacgtccacgtctaccaggtc
tcgcctgcgttatccgttatcgagaagcatactggtaagcggctggctgcgctgtttggg
ctcaatggaccgcgagccggcggaatctctgtacagggcgggtctgcttcgaatacaaca
tccattgtcattgcgcgcaacaatctataccccaatacgaagacagacggtaacggtgac
tacaagtttgtcctcttcactagcgcgcacgggcactatagcattgaaaaagcggctcag
atgctagggctgggaagcagcgcggcctggtcagttccaatcgataaggaaggacgcatg
attccatctgagctggagaagctggtccagaaggcattgagcgagaatcggactcctttt
tatgtcaatgcaacagccggaactacggtcttgggatcctttgatcccttcgatgacatt
gcagcaatctgtaaaaaatacaacctgtggctgcatatcgacggttcctggggcggctca
ttcgccttctcccggcgtcaaagacacaagcttgccggtgcggagaaggcaaacagtatt
gccatcaatcctcacaagatgcttggagttccagtgacttgttccttcctactagcctcg
gacctgcgccagttccaccgcgccaacactcttcctgctggctatcttttccacaacaac
gatgatgaagacgcagttccagttgaaaatggcattggaggattctcagaattaaactcc
gattcccctgaaatctgggacctcgctgatctaaccctccaatgtggccggcgcgccgac
tctcttaaacttttcctcagctggacatattacggcacagctggctacgagcgccaaatc
gataacgcctgcgacactgccgcgtacctcgcaaccataatccaggaccacccggacttc
atcctcgtcagccagaaccccactccctgcttgcaggtctgcttttactacggccctaac
gggaagctcttgcaccctcgcggagacagcatcgtctcggatgagaaccaacgcgcgaag
gctaatagcaaggtcactgagcagatcacgcatgcaattgtagggcgcgggtttatggta
gattatgcgccgcctagcggggatgagaaggcggttggtgatggcaagttcttccggtgt
gtcattaatgtccagacaacgagggagacggttgaggggcttgtgagagcgattgaggaa
gttgggccaggcgtcgtgaaaggactactgtcagagggggcgtcggcggttaagaaaagg
cctggagagcagggtcatggacctgttgtccatcgtgtatga

DBGET integrated database retrieval system