KEGG   Aspergillus nidulans: AN7459.2Help
Entry
AN7459.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00010  Glycolysis / Gluconeogenesis
ani00051  Fructose and mannose metabolism
ani00052  Galactose metabolism
ani00500  Starch and sucrose metabolism
ani00520  Amino sugar and nucleotide sugar metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Module
ani_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ani_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN7459.2
   00051 Fructose and mannose metabolism
    AN7459.2
   00052 Galactose metabolism
    AN7459.2
   00500 Starch and sucrose metabolism
    AN7459.2
   00520 Amino sugar and nucleotide sugar metabolism
    AN7459.2
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AN7459.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AN7459.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AN7459.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 2869351
NCBI-ProteinID: XP_680728
UniProt: P80581
LinkDB All DBs
Position
IV
AA seq 490 aa AA seqDB search
MVGVGPKRPPSRKGSMSDVPQNLLEHIKHFEEIFTVDTATLKKIVDHFVNELTKGLSVEG
GNIPMNVTWVLGFPDGKETGTFLALDMGGTNLRVCEITLTEEKGGFDIIQSKYRMPEELK
TGEAEELWQYIVDCVEQFIQFHHENENLSKLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGKDVVPPLEKVFKERGLPIKVAALINDTTGTLIASSYTDPAMKIGCIFGTGVNAAY
MENAGSIPKLAHMNLPPDMPVAINCEYGAFDNEHIVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALVDILDTQPGLIFKDQDTSQLRIPYLLDSSFPAAIEEDPYENLIET
AELVQNMLKIKATRSELELMRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPSEKDKVTIHAAEDGSGVGAALIAALTLKRVKAGNTAGI
RDAQAMLAMC
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcggagtcggtcccaaacgccctccctctcgcaagggttccatgtcagacgtgccc
caaaatctcctggagcatattaagcactttgaggagatcttcactgttgatactgccacg
cttaaaaagatcgttgaccatttcgtcaacgagctgacgaagggtctctctgttgagggc
ggcaacattcccatgaacgtcacatgggttcttggattccccgacggaaaagaaacgggc
acgttcctggccctcgatatgggcggcaccaacctgcgggtttgtgaaattaccctgacc
gaggagaaaggtggattcgatatcatccaatccaaataccgaatgcccgaggagctcaag
accggcgaggcagaggagttgtggcaatatatcgtcgactgcgtcgagcagtttattcag
ttccaccacgagaacgagaacctatctaaattgccgctgggattcacgttctcctaccct
gctactcaggactacatcgaccacggagttctccagcgctggaccaagggtttcgacatt
gatggtgtcgaaggtaaagacgtagtcccgcctcttgagaaggtcttcaaggaacggggc
ctgcccatcaaggtcgctgccttgatcaacgacacaaccggaaccctcattgcttcttct
tacaccgaccccgctatgaagatcggctgcattttcggcaccggtgtgaatgcagcatac
atggagaatgctggctctattccaaagctggcccacatgaatctgcctccggacatgccc
gtcgccatcaattgcgaatacggtgcctttgacaacgaacatattgtcctcccgctcacc
aagtacgaccacatcatcgaccgcgattcacctcgtcccggccagcaagcttttgagaag
atgacggctggtctgtatctgggcgaaatcttccgcttggccttggtagatattttggac
acacagccgggtctaatcttcaaggatcaggatacctcgcagctgcggatcccatacctt
ctggattcatccttccccgcagctatcgaagaagacccttacgaaaaccttatcgagacc
gccgaactcgtccaaaacatgctcaagataaaagcaacacgctcagagctcgaactgatg
cgccggcttgccgagctgatcggtactcgcgctgctcgcctatccgcctgtggtgttgcc
gcaatctgcaagaagaagaacatcgagtcttgccacgtcggggccgacggctcggtattc
acaaaatacccccacttcaaggcccgcggtgctcaggctctgcgtgagatcctcgactgg
gcccccagtgagaaggacaaggtcaccatccatgctgccgaggatgggtctggtgtgggt
gcggctctcatcgccgccttgaccctgaagcgtgtcaaggctggcaacacggccggtatt
cgtgatgcgcaggccatgctggctatgtgctag

DBGET integrated database retrieval system