KEGG   Aspergillus nidulans: AN8689.2Help
Entry
AN8689.2          CDS       T01016                                 

Definition
(RefSeq) HXKG_ASPNG GLUCOKINASE (GLUCOSE KINASE) (GLK)
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ani  Aspergillus nidulans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN8689.2
   00051 Fructose and mannose metabolism
    AN8689.2
   00052 Galactose metabolism
    AN8689.2
   00500 Starch and sucrose metabolism
    AN8689.2
   00520 Amino sugar and nucleotide sugar metabolism
    AN8689.2
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AN8689.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AN8689.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
III
AA seq 489 aa AA seqDB search
MSTVVEEATRIARQFEYSPEQVQRGVKEYIREVEEGLSEEGTTLSQIPTFVTSVPNGTEK
GLYLAVDLGGTNFRVCSIDLHGNHTFSLTQSKIMIPREMMTSGSAKELFLFLARQIESFL
RIHHNEHFEAHLKRKIAGTAREEDLFDLGFTFSFPVRQLGINKGTLIRWTKGFDIPDAVG
QDVCALLQNAIEELNLPVRVAALVNDTVGTLMARSYTSPGETGTFLGAIFGTGTNGAYVE
KLNKITKMAKIEHSDYDKSTGEMIINAEWGSFDNHLSVLPTTEYDRQLDADSNNPGIQMF
EKRVSGMFLGEILRLVLLDLHKSQGLFKPASGSDVFIPESSSLYRQWGIDTSLLSIVEAD
KSKDFEQVKSALKDHLKVERASENDCKAVQTVVHAIGKRAARLAAVPIAATLISTGKLKE
ELVDIGVDGSLVEFYPNFEGYMREAMREVPEVGDAGDKKVRIGISKDGSGVGAALIALVA
SKEGTKPPL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgtggtagaagaggctacgcgcattgctcgccagttcgagtactcgccggag
caagtgcagcgcggagtgaaggagtacatcagggaggttgaggagggattgtccgaggag
ggcacaaccttaagtcagatcccgaccttcgtgacgtctgtgcccaatggcactgagaag
ggcttgtacttggccgttgaccttggaggcaccaacttccgagtctgctccatcgacttg
cacggcaaccataccttctccctcacgcagtccaagatcatgattcctcgcgagatgatg
acgtcaggatcagcaaaggagctcttcctctttcttgcgcgtcagatcgagtccttcctg
cgcatccatcacaacgagcattttgaggctcatttgaaacgcaagattgccggaacagcc
agggaggaggatttgtttgatcttgggttcacatttagctttcctgtgcgccagttggga
attaacaagggtacgcttattcgctggacgaagggcttcgacattcccgacgccgtaggc
caggatgtttgtgcgctcctgcaaaatgccatagaggaactgaacctccctgtgcgcgtg
gctgcgcttgtaaacgataccgtcggtacgctcatggctcgttcatacacgtctcctggc
gagactggaacttttctcggtgcgatctttggaacaggcacgaacggtgcctacgtcgaa
aaactcaacaagattaccaagatggccaagattgagcactctgattacgacaagtcaacc
ggcgagatgatcatcaatgctgaatggggtagcttcgataaccatctgagcgttctgccc
actacggaatacgatcggcagctggatgctgacagcaacaacccgggtattcaaatgttc
gaaaagcgcgtctctggtatgttcttgggcgagattctgcgtctggtcttgctcgacttg
cacaagtcccaaggtctctttaagccggcttcggggtcggatgtcttcatcccagagtcg
tcttccctctaccgacaatggggtattgacactagtcttctgagtattgtcgaggcagat
aagagcaaggatttcgagcaggttaaatccgcgctgaaggaccacctgaaggttgagcgg
gcgagcgaaaatgactgcaaggcagtccaaaccgttgttcatgctatcggcaaacgtgcg
gcccgcctggctgctgttcctattgccgccaccctcatttccacgggcaagctgaaggaa
gagctggtggacatcggcgttgacggcagcctggttgagttctaccccaactttgagggc
tatatgcgtgaagccatgcgcgaagttcctgaggtcggtgatgcgggagacaaaaaggtg
cggataggtatctcaaaggacggcagtggagttggcgcggctcttattgctctcgtcgca
agcaaagaggggacaaagcccccgctgtga

DBGET integrated database retrieval system