KEGG   Aspergillus oryzae: AOR_1_562034Help
Entry
AOR_1_562034      CDS       T01018                                 

Gene name
AO090103000342
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
aor  Aspergillus oryzae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AOR_1_562034 (AO090103000342)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOR_1_562034 (AO090103000342)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOR_1_562034 (AO090103000342)
   00430 Taurine and hypotaurine metabolism
    AOR_1_562034 (AO090103000342)
Enzymes [BR:aor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AOR_1_562034 (AO090103000342)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 514 aa AA seqDB search
MVHLAQVHRNADLDSTIKRVDSIQLENTDEDGFYSSVYGTRFATEQLPQTEMPEREMPRE
VAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMTESFSKNFIDYEEYPQSAEIQNRC
VNMIARLFNAPVHSEDEHPMGTSTIGSSEAIMLGTLAMKRRWQNKRKAEGKDYSRPNIVM
NSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPQQAVDLVDENTIGICAILGTTYTGEYE
DVKAINDLLIERNIDVPIHVDAASGGFVAPFINPKLEWDFRLPKVVSINVSGHKYGLVYP
GVGWVVWRSPEYLPKDLIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYRSI
MTNITVTADFLAQELEKMGFIIMSQRRGHGLPLVAFRLPAEREGQFDEFALAHQLRERGW
IVPAYTMAPNSNNLKLMRVVVREDFTKSRCDALLSDIKLGLKTLGDMDKAMLDKYTQHVR
THATHSHKSKHNHPHYKGETHSLQGKHGKTHGVC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtccacctcgctcaagtccaccgcaacgctgatctcgacagcaccatcaagcgtgtc
gactccattcaattggagaacactgacgaagatggattctactctagcgtctacggaaca
cggttcgcaacagaacagctgcctcagactgagatgccggagcgggagatgcccagagag
gtcgcctatcgcatgattaaggacgagttgagcctcgatggaaacccaatgctcaacttg
gcgagttttgtcacgacctatatggaagatgaagccgaaaagctcatgactgaatccttc
agcaagaacttcatcgattacgaggagtatcctcagtcagcggagatccagaaccgctgc
gtcaacatgattgcgcgtctgtttaacgcgccagttcacagcgaagacgagcacccgatg
ggcacctcgaccatcggatcgtccgaggcaatcatgctgggtaccctggctatgaagcgc
cgttggcaaaacaagcgcaaggctgaaggcaaggactactcccgccctaacatcgtcatg
aacagcgctgtacaggtgtgttgggaaaaggccgcacggtactttgacgtcgaggagcga
tatgtgtactgcaccgaggaccgctatgtgattgatccccagcaggcggttgacctggtt
gacgagaacactatcggtatctgcgctatcctcggaaccacctacaccggtgagtatgaa
gacgtcaaagcaatcaatgaccttctgatcgaacgcaacatcgatgttcccatccatgtt
gacgccgctagcggcggtttcgtcgctcctttcatcaaccctaagttggaatgggatttc
cgcctcccaaaggtcgtttcgatcaacgtgtctggccacaagtatggtctggtctaccct
ggcgtgggctgggtcgtctggcggtccccggaatatctccccaaggatctgattttcaac
atcaactacctaggagctgaacaggccagttttaccctgaacttctccaagggtgcatct
caggtcatcggccagtactaccagatgatccgacttggcaagcgtggctaccgctccatc
atgaccaacattactgttactgcggactttttggcccaagagctggagaagatgggcttt
atcatcatgagccagcgtcgcggccacggtctcccattggtcgctttcagactgcccgct
gagcgggagggtcagttcgacgagtttgccttggcacaccagctgcgtgagcgtggctgg
attgtccctgcatacacgatggcgcccaacagcaacaacctgaagctgatgcgtgtggtt
gtccgcgaggatttcacaaagagccggtgcgacgcgctgcttagtgatatcaagttgggc
ctgaagacgttgggtgacatggacaaggccatgttggataagtacacccagcacgtccgc
acccacgccacccactcgcacaagtccaagcacaaccaccctcactacaagggagagacg
cactccctgcagggtaagcatggcaagactcatggtgtttgctag

DBGET integrated database retrieval system