KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_88359Help
Entry
BRAFLDRAFT_88359  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    BRAFLDRAFT_88359
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     BRAFLDRAFT_88359
Peptidases [BR:bfo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   BRAFLDRAFT_88359
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_88359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 242 aa AA seqDB search
MHFFVLLALVSYAAAEGYEDRIIGGFEATPGSVPWQVSLQRSGSHFCGGTLLNSQWVLSA
AHCLVSGMTVVAGEHDLSRNDGHEQSRGVERIIPHPNYNDNTLDNDIMLIKLSSPVTISS
WVSPASLPDSMVSAGTNVIVTGWGNTGSNYPDKLQKVRVPVISRATCNGANAYAGAVTTN
MFCAGYMDGGKDSCQGDSGGPVTRSGTVYGVVSWGYGCAQPNYPGVYTKVKKYTSWINVY
IN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcttcgttcttcttgctcttgtctcttacgctgcggcggagggatacgaagac
cggattattggcggtttcgaggcgaccccgggtagcgtcccgtggcaggtgtccctacag
cggtccggcagccatttctgtggcggcacgctcctcaacagtcaatgggtcctcagcgcc
gctcactgcctagtcagtggcatgactgtggttgctggagagcacgacttgagcagaaac
gatgggcacgaacagtcgcgtggcgtagaacggatcataccacatccaaactacaacgac
aacacgctggataacgacatcatgctcatcaagctcagctctcccgtcacgatcagctct
tgggtcagccccgcgtctctgcctgactccatggtttcggccgggaccaatgtcatcgtc
acgggctgggggaacactggatctaactacccggacaagctgcaaaaggtccgagtgccc
gtcatctcccgcgccacctgtaacggcgctaacgcttacgccggcgcagtaaccaccaac
atgttctgtgcaggctacatggacggcggcaaggactcctgccagggagacagcggcggc
cccgtgacgaggtccggtactgtgtacggcgtggtgagttggggttacggctgtgcccag
cccaactacccgggagtctacaccaaggtgaagaaatacaccagctggatcaacgtctac
atcaattaa

DBGET integrated database retrieval system