KEGG   Botrytis cinerea: BC1G_04254Help
Entry
BC1G_04254        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
bfu  Botrytis cinerea
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BC1G_04254
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     BC1G_04254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 1128 aa AA seqDB search
MEQPHQGGPARRLTLGVPKKSTSGNASSNPQVFEGPDHSVKRAGIVGTLESLGKVISTAN
RPLNTETGDGSYDTKQEQSGLLDDLKALRIKDLETLQMTMKQELGSSNLADDKTMLMEKL
IQLVANLPGTSKTRVKLTEVLVDELWGSLEHPPASMLGDKYNYRQADGSFNNIRFPDIGK
AGTAYARSVTPKIVQPNPKPDPGLIFDTIMSRENGGFKPHPNNISSMLYYIASIIIHDCF
RTSHEDFNISMTSSYLDLSPLYGSNQDEQNNMRTLKDGELKPDCFSEKRLLGFPPGVGCI
LIMFNRFHNYVVKQLATINENGRFTPPKDNLPDDKKQAAWKKYDNDLFQTGRLITCGLYI
NIILLDYLRTIVGLNRVNSTWTLDPRIEMERNSKPGTEAGVGNQCAAEFNLVYRWHSCIS
QRDEKWSEDLYMKIFGKSYKEVTMQELLIGLGKLEAMTPEDPLQRDFAGMKRGTDGKLND
DDLVNELTASIEDLAGSSGANNVPAVLRAVEILGMEQARAWKCATLNEFRKHFGLIPHEK
FSDINSDPAVYEKLKVLFDEPDLVELYAGLVCEDAKKPMDPGVGIGPTYTISRSILSDAV
TLVRGDRFYTTDYHPANLTNWGVTEVKYDLNVNQGCVFYKLFIRAFPNHFSYNSIYAHYP
LTIPSENKKIMEKLGRADDYSWDKPVKVPERKNIVTFDGVKSVLTNAEVFGVDNWRRGLA
YLMGKPGANFMLAGDGDFFAERRNQMKECLYQDKWHESVKNYYESIVPRLLKRWSYNIGG
TTNQVDVIRDIDNSAHVHFAANVFHLPLKTEENPKGVYTEHELYMVLAVIFIVIFFGDVD
PAKTFSLRAAGLPVTQDLGQLVEQNVNFISKTSLVSGIVDTFMEENNALKDYGVHMVRHL
LKAGLGVHETVWSQILPTAGAMVANQAQVFGQVLDFYLGDGKEHLPEINRLAKLNTAEAD
DILLHYLLEGIRMYGTFGAYRTCHQNITINDGSRKVECKPGDSVFVSFVSLAQDPKIYPD
PKTVRLDRPVDSYLVYGVGSHACLGGEASRVALTAMLKCIGRLDNLRRASGPQGEMKKVP
REGGFYVYMDKMMGSEFPFPTTMKICWDGGLNEPVPVVEKGKGKKNGA
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacctcatcagggcggcccagcacgtcgtttgactttaggtgtgcctaaaaag
tctactagtggtaatgcaagctccaatcctcaagtattcgaaggtcccgatcacagtgta
aaacgcgctggtatcgtaggaactctcgagtcactcggaaaagtcattagcacggccaat
cgtcctttaaacaccgaaactggagatggctcatacgatacaaaacaagagcagtcgggc
ttgttggatgatctcaaagcattgcgaattaaggatctggaaacattgcagatgactatg
aagcaagaactaggatcctcaaatctagcagatgataagaccatgttaatggagaagctt
attcagttggttgcaaaccttcctggaacctccaagactcgagttaagcttacggaagta
ctcgttgatgagctatggggatccttggaacatccaccagcttcaatgcttggtgataag
tacaattaccgacaagctgatggctcattcaataacatcagatttcccgacattggaaaa
gcaggcacagcatacgctcgaagtgttactccaaaaattgttcaaccaaacccaaaacca
gatccaggccttatattcgacacaatcatgagtcgagaaaatggtggattcaagccccac
ccgaacaatatatctagtatgctttactatattgcaagcattatcattcatgactgcttc
cgtacctcgcacgaagatttcaatatttcaatgacctcctcttatttagatctttctcct
ttgtatggaagtaaccaggatgaacaaaataacatgcgcacacttaaagatggagaacta
aaaccggattgtttctccgagaagagattgttaggttttcctcctggagttggatgcatt
cttattatgttcaatcgttttcacaactatgtagtgaaacaattggcaacaataaacgag
aatggacgctttacaccccccaaagacaatctaccagacgataaaaagcaagcagcctgg
aagaagtatgataatgatctatttcaaaccggacggcttattacttgcggtctctacatt
aacatcattctgctcgattatctccgcacaatcgtcggtctgaatcgagtcaattctacc
tggactcttgatcctcgaatcgaaatggaaagaaacagcaagcccggaactgaagctgga
gtcgggaaccaatgtgctgccgaattcaatctcgtgtatcgatggcattcctgtatcagt
caacgtgatgagaaatggtcagaagatctgtacatgaaaatctttggaaagagctacaag
gaagtcaccatgcaggagcttctcattggtttgggtaaactcgaagcaatgacaccagaa
gatcccctacaacgagatttcgctggtatgaagagaggcactgacggaaaactcaatgat
gatgatcttgtcaacgagttgaccgccagtatagaagacttggctgggtcatcaggagca
aataacgttcctgcagtcctgcgtgctgttgaaatccttgggatggaacaagctcgtgca
tggaagtgcgcaactctaaatgaattccgcaaacactttggccttataccacatgaaaag
ttttcagatatcaattcagatccagccgtctatgaaaaattgaaggttctgttcgatgag
cctgatttggtcgaactttacgccggattggtttgtgaagatgccaagaagcctatggat
ccaggtgttggcattggaccgacctatacaatcagtcgtagcattctttctgacgcagtt
acattggttcgtggtgacagattttataccaccgactatcatccagcaaaccttacgaat
tggggcgtcaccgaagtcaagtatgatttaaacgtcaatcaaggttgcgttttctacaaa
ttgttcatccgagctttcccaaatcatttctcgtataatagcatatatgcccactatcct
cttacgataccgtctgaaaacaaaaagattatggagaaactcggccgtgcagatgattac
agctgggacaaaccagtcaaggttccagaacgaaagaatattgtcacctttgatggagtc
aagagtgttcttaccaatgcagaagtgtttggcgttgataattggcgcagaggtcttgct
tacctcatgggaaaaccaggtgctaatttcatgttggctggtgatggcgacttctttgca
gagcgtcgtaatcaaatgaaggaatgtctttaccaagacaaatggcacgagagtgtcaag
aactactacgaaagtattgttccaagactcctcaagagatggtcctacaatatcggtggc
acgaccaaccaggttgatgtcattcgcgatattgataattccgctcatgtacactttgcc
gccaatgttttccacctaccactcaagaccgaagagaatcccaaaggtgtatataccgag
catgaattgtacatggtgttggctgttatcttcatcgttatattttttggtgatgtcgac
ccagccaaaacgttttcattacgtgctgctggtcttccggttacacaagatcttggtcaa
ctagttgagcaaaacgtgaactttatctcaaagactagtcttgtatcgggtatcgttgat
actttcatggaagaaaacaacgcacttaaagattacggtgtgcacatggtgcgccatttg
ttgaaggctggcttgggcgttcatgagactgtttggtcacaaattttgccaacagcagga
gcaatggtagcaaaccaagcacaagtttttggtcaagtcctcgacttttatcttggtgat
ggcaaagagcatcttccggagattaaccgtcttgcaaagctcaacacagcagaagcagat
gatattctcttacattacctgttggaaggaattagaatgtacggcacattcggtgcttac
cgaacatgtcatcaaaacattaccatcaacgatggatctcgaaaagtcgagtgcaagcct
ggcgattcagttttcgtcagtttcgtttcactagcccaggaccctaaaatctatcccgat
ccaaagacagttcgtctagatcgtccagttgattcttacctcgtgtatggcgtcggttcc
cacgcttgtctcggcggtgaagcttcgcgtgtagctcttacagccatgcttaaatgcatt
ggccgacttgacaatttgagaagagcatctggtcctcagggtgaaatgaagaaggttcca
agagaaggaggattctatgtttatatggataagatgatgggatccgaattccccttcccg
actacgatgaagatttgttgggatggagggttgaatgaaccggtaccggtggtggagaag
gggaaaggaaagaagaatggcgcatga

DBGET integrated database retrieval system