KEGG   Botrytis cinerea: BC1G_11188Help
Entry
BC1G_11188        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bfu  Botrytis cinerea
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    BC1G_11188
Enzymes [BR:bfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     BC1G_11188
Chromosome [BR:bfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     BC1G_11188
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    BC1G_11188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 356 aa AA seqDB search
MNTISKCNINGELNEPNKSSFHSDLKKLKEGKKLKEAARMLNAYSMSIMAPTYRDHYFGH
EIPSLKDCHWCQIRSFSNANEYPISIVCKDESLTLPSDFTFIEKSILREGVSRADPEFRV
GCECSHSCHGMTCHCLQDSEVDLPDHNVYAYQAGGNSEGCLKEQLLDSKAPIYECHEACA
CDETCDNRIVARGRRVPLQVFRTENRGWGVRSKVPIKAGAFIDCYIGEIITAQEAERRRD
NAIISRRKDLYLFSIDKFTDPDSLNETLRGDPYVIDGEFYAGPSRFFNHSCEANMRIFAR
VGDYSEKNLHDLAFFAIEDIRPMTELTFDYVDGKDDGEQGSEKCLCGAKSCRGWLW
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaatttcaaaatgcaacatcaacggtgaattgaacgagccgaataagtcgagt
ttccatagtgatttgaagaagttgaaagaggggaagaagttaaaggaggcagcgcgtatg
ttgaatgcttattcgatgagtatcatggcgccaacgtatagagatcactattttggtcat
gagattccatccctcaaagattgtcattggtgtcaaatccgcagcttctccaatgcaaac
gaatacccaatctccattgtctgcaaagacgaaagtctaactctcccttccgattttacc
ttcatcgaaaagtctattctcagagaaggggtttcccgagccgatcctgagtttcgagtc
ggatgtgaatgcagtcacagttgtcatggaatgacttgccactgcctccaagattctgag
gttgatctaccagatcacaatgtatatgcctatcaagcagggggtaatagcgaaggatgt
ttgaaagaacagcttttggatagcaaagcgcctatctatgagtgtcacgaagcctgtgct
tgtgatgaaacttgtgataatcgaattgttgcaagaggacgacgcgtgccattacaagtt
ttccgcactgaaaatcgtggttggggtgttcgaagcaaagttcccatcaaagccggtgca
tttatcgactgctacattggcgagataatcaccgctcaggaagccgaaagacgccgcgac
aatgcaatcataagtagaagaaaagatctttatctattcagcattgataagttcaccgat
ccagatagtctcaatgagactttacgtggtgatccatatgttattgacggagaattttac
gcgggacctagtcgtttctttaaccattcctgtgaagccaatatgaggatctttgcgcgt
gttggagattactctgagaaaaaccttcatgacttggcattttttgcgattgaggatatt
cgaccaatgacggaacttactttcgactatgtggatggaaaggatgatggagagcaagga
agtgagaaatgcttgtgtggggctaaatcgtgtagaggatggctttggtaa

DBGET integrated database retrieval system