KEGG   Botrytis cinerea: BC1G_12086Help
Entry
BC1G_12086        CDS       T01072                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bfu  Botrytis cinerea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_12086
   00051 Fructose and mannose metabolism
    BC1G_12086
   00052 Galactose metabolism
    BC1G_12086
   00500 Starch and sucrose metabolism
    BC1G_12086
   00520 Amino sugar and nucleotide sugar metabolism
    BC1G_12086
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BC1G_12086
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     BC1G_12086
Membrane trafficking [BR:bfu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    BC1G_12086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 491 aa AA seqDB search
MVGLGPRKPPSRKGSMADVPKNYLEQIKKLEQQFTVDTQKLKEITEHFVSELTKGLTVEG
GSIPMNPTWCMAFPDGYETGTFLALDMGGTNLRVCEIILTDEKSEFDIIQSKYRMPEELK
TGEADELWEYIADCLQQFIESHHHGEDLGTLSLGFTFSYPATQNYIDEGILQRWTKGFDI
AGVEGENIVPMFEAALAKRGVPIKLTALINDTTGTLIASAYTDTAMKIGCIFGTGCNAAY
MENCGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHDNKDIHMFEGQDIEKLRKAYTLDSSFLSLVEEDPWENLSET
ADLFQNKLSIRATVPELELIRRLAELIGTRAARLSACGVAAIAKKKNYETCHVGADGSVF
NKYPHFKARGAAALREILDWPAKKNAKEADPIEILAAEDGSGVGAALIAALTLKRVKAGN
MAGILHPENFR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtggggttaggtccaagaaagcctccttcccgtaagggttctatggctgatgtcccc
aaaaattacttggaacaaatcaagaagcttgagcaacagttcactgttgacacccaaaaa
ctcaaggagatcactgaacacttcgtctccgagcttacaaaaggtctcactgtagagggt
ggaagtattccaatgaacccaacttggtgtatggcatttccagatggttatgaaaccggt
acattcctcgccttggacatgggaggtaccaacttgcgtgtctgtgaaattatcttgact
gatgagaagtccgagtttgatattatccaatcaaaataccgcatgccagaagagctcaag
actggcgaagcagatgaactttgggaatacattgccgattgtcttcaacaattcattgaa
tcccaccatcatggcgaggatcttggaacgttgagtcttggtttcaccttctcctaccca
gctactcaaaactatatcgatgagggtatcttgcaaagatggaccaagggcttcgatatt
gcaggtgtcgaaggtgaaaacattgttccaatgtttgaggcagctcttgctaagagaggc
gttccaattaagcttacagctttgatcaatgataccactggtaccttgattgcttccgca
tatactgacacagccatgaagattggttgtattttcggaactggttgcaatgctgcgtac
atggaaaactgcggctctattccaaaattggcacacatgaacttacctcctgacactcca
atggcaatcaactgcgagtggggtgctttcgataatgagcacaaagttctcccccgtact
ccatacgatatcattattgataaagattctccacgtcctggtcagcaagcatttgagaag
atgattgctggtctttaccttggagaacttttcagattggttcttgtcgatcttcatgac
aacaaagatatccacatgtttgagggtcaagatattgaaaaactccgaaaggcttacacc
ttggactcttcattcttgtcattggttgaggaggacccttgggagaacttgtcagaaact
gctgatcttttccaaaacaagctcagcatcagagccactgttccagaactcgagctcatc
cgtcgccttgctgagttgatcggtacccgtgccgcccgcctctccgcatgtggtgtcgcc
gccattgccaagaaaaagaactacgagacttgccacgtcggagctgacggatctgtcttc
aacaaataccctcacttcaaggctcgtggtgccgccgcactccgtgaaattcttgattgg
cctgcaaagaagaatgctaaggaggctgatcccattgaaatcttggctgctgaggatgga
tctggtgtcggtgcagctttgattgctgctttgaccctcaagcgtgtcaaggcaggtaac
atggctggtattttgcacccagagaacttcagatag

DBGET integrated database retrieval system