KEGG   Caenorhabditis briggsae: CBG14607Help
Entry
CBG14607          CDS       T01054                                 

Gene name
Cbr-acn-1
Definition
(RefSeq) C. briggsae CBR-ACN-1 protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CBG14607 (Cbr-acn-1)
Peptidases [BR:cbr01002]
 Metallo Peptidases
  Family M2
   CBG14607 (Cbr-acn-1)
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBG14607 (Cbr-acn-1)
CD molecules [BR:cbr04090]
 Proteins
  CBG14607 (Cbr-acn-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
WormBase: 
UniProt: 
LinkDB All DBs
Position
X
AA seq 905 aa AA seqDB search
MKFNILLLLLVGACLPSFSQEIKPKSELLPGDEAPKDPEVAFAEGEPFELTDALDTPKNG
TVPVPEPEPKPEPEPEPEPEPSPKSEPEPEPTPEPEPAIKFDNIESEDYGDVAEAVVTQP
DELNTEVIEQLVDTFLNTGSIAPNKTNKGPVYANPVAQALVNSSDYWKADNLQAPGSIKD
EEKLRSWLAGYEAEAIKVLREVALSGWRYFNDASPSLKLALDEAENVLTMFVKSTSMQAK
QFDKASVTDERLKRQLGYVSFEGMSALAPSRFAEFSQAQSTLNRDSKDSTICDKDVPPPC
ALQKIDMDSIFRNEKDASRLQHLWVSYVTAIAKSKPAYNNIIAISNEGAKLNGFANGGAM
WRSAFDTPSNMADLTKQVEKIYSTIQPFYQLLHAYMRRQLAGIYSNPAGLSKDGPIPAHL
FGSLDGGDWSAHYEQTKPYEEESETPEAILAAFTSQNYTTKKMFVTAYRYFKSAGFPQLP
KNFWTSSIFARVWSKDMICHPAAALDMRAPNDFRVKSCAQLGEPDFEQAHSLLVQTYYQY
LYKDQSLLFREPASPVITDAIASAFAYLATNPHYLYSQKLVPSDHLDIKNSVIINKLYKE
SLESFTKLPFTIAADNWRYELFEGKVPKNKLNDRWWEIRNKYEGTRSPQPYNTSNLDALI
HNSVSQVNSPATRSLISYVLKFQILKALCPEGTILSEGCILSEDTTEKLRETMKLGSSIT
WLKALEMITGKGELDAQPLLEYYEPLINWLRNTNEIDQVVIGWDGEGTPFTVEEIPKTRQ
PGDGGNGLPSEDRVAFPGGECVNGQECLLDSHCNGTICVCNEGLFTLEIGNTFNCVPGNP
ADSGFGDGKGGLVIGLFNNEATTPEPAAEPEPTTVTSTKMPPRVRSSAALPTFLLTVLPV
FYYLL
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaacatacttctcctattgcttgtgggggcctgtttgccatcgttctcccag
gagatcaagccaaagtcggaacttctgccaggagacgaagcaccaaaagatccagaagtc
gcatttgctgaaggtgaaccatttgaactcactgatgcactagacacaccaaaaaatggc
actgttccggtccctgagccagagccaaagccagagccagagccagaaccagagccagaa
ccaagtccaaaatctgagccagaaccagaaccaactccagagccagaaccagccatcaaa
ttcgacaacatcgagtctgaagactatggagatgtcgctgaagctgtcgttactcaacca
gatgagctcaacaccgaggtcatcgagcaacttgtagacactttcttgaataccggatca
attgccccaaataagaccaataagggaccagtttatgccaaccccgtcgctcaagcactt
gtgaacagcagcgattactggaaggccgacaatcttcaggcgccaggatctatcaaagac
gaggagaaacttcgttcctggctggccggatacgaggcagaagccattaaggtccttcgt
gaagttgctctctccggatggcgttatttcaacgatgcttccccatccctcaagcttgct
ctcgatgaagctgaaaacgttcttaccatgttcgtcaaaagcacgtctatgcaagccaag
caattcgataaagcatcagtgaccgatgaaagactcaagagacaactcggatatgtttca
ttcgaaggaatgtccgctcttgccccatcccgattcgccgaattctctcaagctcaatcc
acccttaacagagactccaaggactcgaccatctgtgataaggatgtgccaccaccatgt
gctcttcaaaaaatcgatatggattctatcttccgcaacgagaaagacgcttctagactc
caacacttgtgggtttcttatgtcaccgctattgctaagagcaagccagcttacaacaac
atcattgctatctccaacgaaggagccaagctcaacggatttgccaatggaggagccatg
tggagaagtgccttcgatacgccttcaaacatggcggacctaaccaagcaagtcgagaag
atctactctaccatccaaccattctatcaacttctccacgcttacatgcgtcgccagttg
gcaggaatctactcaaacccagctggacttagcaaggacggaccaattccagcacatctt
ttcggatcactcgacggaggagactggtctgctcattatgaacaaaccaagccatatgaa
gaggaatctgagactccagaagctattctcgccgctttcacaagccaaaactacactacc
aagaagatgtttgttactgcatatcgctatttcaaatctgctggattcccacaacttcca
aagaacttctggaccagctctattttcgctcgtgtctggagtaaggatatgatttgccac
ccagccgccgctctcgatatgcgtgcaccaaatgatttccgtgtcaaaagttgtgctcaa
ctcggagagccagatttcgaacaagctcattctcttctcgtccaaacttactaccagtac
ctgtacaaggatcaatctcttctcttcagagagccagcctctccagttatcactgacgcc
atcgccagcgctttcgcctatcttgccactaacccacattacttgtattctcagaaactt
gttccatccgaccatttagacattaagaactccgtgatcatcaacaagctttacaaggag
tcgctcgaaagcttcaccaaactgccattcacgattgccgctgacaactggagatacgag
ttgttcgagggcaaagtgccaaagaacaagttgaatgacagatggtgggagattagaaac
aagtatgagggaactcgctctccacaaccatacaacacttccaacttggacgctctcatc
cacaactctgtatctcaagtcaattccccagctactcgctctcttatcagctatgttctc
aagttccaaatcttgaaggctttatgtccagagggaactatcttgagcgaaggatgcatc
ttgtctgaggatactaccgagaaacttcgtgagaccatgaagttgggatcttcgatcact
tggttgaaggctcttgaaatgatcactggaaagggagaactcgatgctcaaccacttctc
gagtactacgagccacttatcaactggcttcgtaacaccaatgagattgatcaagttgtc
attggatgggacggagaaggaactccattcactgtcgaagaaattcctaagaccagacaa
ccaggagatggaggaaacggacttccaagtgaagatagagttgccttcccaggaggagaa
tgtgttaacggacaagaatgtcttctggattctcactgcaacggaaccatctgtgtctgt
aacgaaggtctcttcactttggaaatcggaaacaccttcaactgtgtgccaggaaatcca
gctgatagtggatttggagatggaaagggaggacttgtcattggactcttcaacaacgaa
gccacgacaccagagccagctgccgagccagaaccaactacagtaaccagcacaaagatg
ccaccacgagtgagatcgtctgctgctcttccaactttcttattgactgttctaccagtt
ttctattatcttttataa

DBGET integrated database retrieval system