KEGG   Drosophila erecta: Dere_GG10506Help
Entry
Dere_GG10506      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dere_GG10506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 776 aa AA seqDB search
MGQKLSCGKECGDWRWCTTKDREEPTLRMRNANANYFTAAPQGDQTDGASSAVLGVLRVD
LCQEDNHDEHHTSHFYAAAAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVADDTK
PTPGHGTLNALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDTK
LLGDGSRSYALPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVW
KIGQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFS
GGVAPTKWTGSVEILQQFHKTQKSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDT
QASLTVDVFIDSNNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQAVDATPQ
EASDNMYRVGPASVSAVKNGDILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLA
IGHLISTKAVLKWEREDITDTYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNEIEF
DMELKDDIKIGQSFSVILKVTNKSESRTHMATGQISCDAVLYTGVGAVEVKTLGFELELA
PKSSDYVRMEVIFEEYYDKLSSQAAFQISAAAKVKNTDYDYYAQDDFRVRKPDIKFQLGE
AAIVAQKELDVILRLENPLPIPLHKGLFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYTP
PYAGRGTMLAKFTSRELDDVDGYRHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVID
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaactatcctgtggcaaagagtgcggcgattggaggtggtgcacaactaag
gaccgcgaggagccaacgctgcgtatgcgcaatgccaatgccaactatttcacggctgct
ccacaaggcgaccaaacagatggcgccagctcggcagtgctgggtgtgttgagggtggat
ctgtgccaggaggacaaccacgatgagcaccacacgagccacttctacgcggcggctgcc
aaggaagccctggtggtgaggcgcggagagcccttcaggctgaagatccacttcaatcgg
gactacagtcccagcaaggatgccatcagcttcattttcacggtggcggatgacaccaag
ccgacgcccggacatggcacactcaatgcgctggtgccgcacgatggcatcgattatctg
ggggacactttggaatggggagccggcattgaatcgcatgagggtcaaacgctcacggtg
ctgattaagcccccatccacctgtcccgtgacggagtggaaactggacatcgacacgaag
ctgctgggcgatggatcgaggagctatgccctgccgctgcccatctatgtgctcttcaat
ccttggtgtccggacgaccaggtgtacctggaggatcgcgaccagcgcaaggagtacgtg
atgcacgataccacactcatctggaggggatcctacaacaggctgcggccatcggtttgg
aagatcggccaattcgaacggcatgtgctcgagtgcagcctgaaggtactgggaacggtg
ggcaggattccaccggcctacagaggcgatcccgtgagggtcgctcgtgccttgtccgct
ctggtgaactcggtggatgatgatggtgtcctgctcggcaactggtcggaggatttctcc
ggcggcgtggcacccaccaagtggaccggctccgtggaaatccttcagcagttccacaag
acccagaagtcggtgaagttcgcacagtgctggaacttcagcggtgttttgaccaccatt
gccaggagtctgggaataccctctaggatcatcacttgctactcctccgctcacgataca
caggcctccctcaccgtggacgtgttcatcgactccaacaacaagaagttggatgcggag
accacggactcgatctggaactaccacgtgtggaacgagctctggatgcagcgacccgac
ttgggagtgggtgagcatggcaccttcgacggctggcaggcggtggacgccactccgcag
gaggcctccgataacatgtatcgagtgggtcccgcttccgtttcggcggtgaagaacggc
gacatcctgaggcccttcgatggtggcttcgtcttcgcggaggtgaacgcggataagctc
tattggcgctacaatggacccagtcagccgctaaagctgctcaggaaggataccctggcc
ataggacacctcatcagcacgaaagcggtcctcaagtgggaaagggaggacatcaccgat
acctacaagcatgccgagcgctccgaggaggaaaggagcaccatgctcaaggccctcaag
caatcccggcatgcgttcagtagatactacctgaatgacaacttcaatgagattgagttc
gatatggagctgaaggacgacatcaagattgggcagagcttcagtgtgatcctgaaggtg
accaacaagagcgagagtcgcacccacatggccacgggccagatcagttgcgatgccgtg
ctctacaccggagtgggtgcagtggaggtcaagactctgggcttcgagctggaactggcg
cccaagagcagcgactacgtgcgcatggaggtgatcttcgaggagtactacgacaagctg
tcctcgcaggccgccttccagatctccgcggccgccaaggtcaagaacaccgactacgat
tactatgcgcaggatgatttccgggtgcgcaagccggacattaagttccagctgggcgag
gctgccattgtggcccagaaggagctggacgtgatcctgcgcctggagaacccgctgccc
attcctctgcacaagggtctgttcacagtggagggtcctggtatcgagcagcccctgaag
ttcaagatcgccgaaattccagtgggtggcactgcggctgccaccttcaagtacactccg
ccctacgcggggcgtggcaccatgctggcgaagttcacgtccagggaactggacgatgtg
gatggctacaggcactatgaaatcgagccacgtccggaggatctgctgcagcccaatgga
agccaccgcagcagcaacatcatccgcagacgcaccgacgtaatagactaa

DBGET integrated database retrieval system