KEGG   Drosophila grimshawi: Dgri_GH11127Help
Entry
Dgri_GH11127      CDS       T01061                                 

Definition
(RefSeq) GH11127 gene product from transcript GH11127-RA
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dgri_GH11127
Peptidases [BR:dgr01002]
 Metallo Peptidases
  Family M2
   Dgri_GH11127
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH11127
CD molecules [BR:dgr04090]
 Proteins
  Dgri_GH11127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 851 aa AA seqDB search
MWHCLIIIYTTIWGLVYANPQLNLPTPQPEIFYNGYTPNVATTPSQLKADRDRSQRYGPP
YSGDGGRSGSGSSDDGFDDFRYGQTYDERMRLGYAYPTPRLNFTERTDDSPFSGDVNRDR
GPDNRYANHNYGPTSTSTDRNYGNFNDQPNNRPYADENPNAQYNYNNNPNVEFVGLNNNR
NRFENPYLSNQDRFNLNQAYVDRQRFQQDRRYQQELEKLRNLLVETDQKGSLECTANVAA
QWNFETNVNDFTQTEALNAQQRYVEYQRITAQQSKRINKDLIFDRRLYRQLMLQSEAGPN
ALPIDVLDRYNRLLNEMLFLYNDASICAYQQPFQCDLHYIPHLKDIMAKSRDWDELQHTW
VEYHRKAGRGMRDNYEQLIDVMQDVASVNNVTNGGEYWYLAYESGNFRQDMDNVWEQIRP
LYEGLHSYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQSWSNVLDILIPYPGRKLIDVT
PRMVEQGYTPLLMFQLAEEFFTSINMSAVGPDFYRNSVFEQPLDRRVLCEPSAWDFCNRH
DFRVKICTDINQRSLISVHHEMAHIQYFLQYRHHPKIFRNGANPAFHQAVGDAIGLSVST
PKHLQTLGLLQRSLDESSYDINYLFTMAIDKVAFLPFALALDNWRYDVFSGNVNKRIMNC
HYWNLRERYSGIKPPVLRSEKDFDLGAKYHIPANIPYVKYFFSTVLQFQLYRGMCRAAGQ
YVPNDPRKPLHKCDIYRQPAAGNILKDMMAKGASQPWQEVLQETLGEGRLDGSALREYFA
PLEEWLRLEALRTNEYVGWNYDGDYCKRSIETAGLQVFGGYYNGAACRELNLLLLFLSSW
LCYLVVLSSMS
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtggcattgtcttattatcatatacactaccatatggggtctggtctatgctaatccc
caactcaatttgcccacaccacagccggagatattctacaatggctacacgcccaatgtg
gcaacaaccccctcccagctgaaggccgatcgcgatcgtagccagcgttatggaccaccc
tattcgggtgatgggggtagaagtggaagtggcagtagcgatgatggctttgatgacttt
aggtacggtcagacctatgacgaacgcatgcgattgggttacgcctatccaacgccgcga
ttgaatttcactgagcgtaccgatgattcacccttcagcggggatgtgaatcgcgatcgt
ggtccagataatcggtatgcgaatcacaactatggacccacttcgaccagcaccgatcgc
aactatggcaactttaacgatcagcccaacaatcgaccctatgcggatgaaaatcccaat
gcgcagtataactacaataacaatccgaatgtggaatttgtgggattgaacaataatcgg
aatcgtttcgagaatccctatctatccaatcaggatagattcaatctaaatcaggcgtat
gtggaccggcagcgttttcaacaggatcgtcgctatcagcaggagctagagaagctgcgc
aatctgctggtcgaaacggatcagaagggttcgctcgagtgcaccgcaaatgtggcggct
cagtggaacttcgagacgaacgtgaacgattttacacagacggaagcgctgaatgcccaa
cagcgctatgtggagtatcagcgcataacagctcagcagtcgaagcgtattaacaaggat
ctcatattcgatcgtcgtctctatagacagttaatgctacaatctgaagctgggcccaat
gcgctgcccatcgatgtcttggacaggtacaatcgcctgttgaacgaaatgcttttcctg
tacaacgatgccagcatctgcgcctaccagcagccttttcaatgtgacctgcactatata
cctcacctcaaggacattatggccaagagcagagactgggatgaactgcagcatacctgg
gtagagtatcatcgcaaggcggggcgaggcatgcgggataactatgaacagttgattgat
gtgatgcaggatgtggcctctgtaaacaatgtgaccaatggcggggagtactggtatttg
gcctacgaatctggcaactttcggcaggatatggataacgtttgggagcagatacgtccg
ctctacgaaggtctgcattcctatgtgcgtcgcaagctaagggactactatggacctgat
cggattaaccggattgcgccgataccttcacacatattgggcaacatgtacggacagtcc
tggtcgaatgtgttggacatacttataccctatccgggtcgtaagctcatcgatgtgacg
cctcgcatggtggagcagggatatacgccgctgctaatgttccaactggccgaggagttc
tttacctccatcaatatgtcggctgtgggtccggatttctataggaattccgtattcgag
cagccgttggacaggcgagtgctctgcgaaccctccgcctgggacttttgcaatcgtcac
gatttccgtgtgaagatctgcactgacatcaatcagcgcagtctgattagcgttcatcat
gaaatggcgcatattcagtacttcctgcagtatcgtcaccacccgaagatctttcgcaac
ggtgccaatcccgccttccatcaggctgtgggcgatgccatcggtctatctgtatccacg
ccaaagcatttgcaaactttgggcctgcttcagagatcactggatgagtccagctatgat
atcaactatttgttcaccatggccattgataaggttgcttttctgcccttcgccttggct
ttggacaactggcgctacgacgtcttcagtggcaatgtgaataagcgaattatgaactgt
cattattggaatttgcgtgagaggtattcgggaattaagcctccagttctacgctctgag
aaggactttgatttgggcgctaaatatcatatacccgcaaatataccctatgttaaatac
tttttctccacggttctacagtttcagctatatcgcggcatgtgccgagccgctggccaa
tatgtgcccaacgatccgcggaaaccgctgcacaaatgcgacatctatcggcagccagcc
gcgggcaatattttaaaagatatgatggccaagggtgcctcccagccgtggcaggaggtg
ctgcaggaaacattgggcgagggccgcctggatggcagcgctctgcgtgagtactttgct
ccactggaggagtggctgcgtctggaggcgctgcgcaccaatgagtatgtgggctggaac
tatgatggggattactgtaagcgcagcatcgaaactgccggactgcaggtctttggcggc
tactacaatggcgcggcttgccgggaactgaacctgctgctacttttcctcagcagctgg
ctgtgctacctggttgtcttgtctagcatgagttaa

DBGET integrated database retrieval system