KEGG   Drosophila persimilis: Dper_GL15590Help
Entry
Dper_GL15590      CDS       T01063                                 

Definition
(RefSeq) GL15590 gene product from transcript GL15590-RA
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dpe  Drosophila persimilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dper_GL15590
Enzymes [BR:dpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dper_GL15590
Chromosome [BR:dpe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dper_GL15590
   Polycomb group proteins
    PRC2-EZH2 complex
     Dper_GL15590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 749 aa AA seqDB search
MSNAKVPPEWKRRVKSEYFKIRQQKRHKRADEIKEAWIKNWDEHNHNVQDLYCESKVWQA
KPYEPPHVGCVKRAEITSYSGNPSGPQRVPICVINAVTPIPTMYTWAPTQQNFMVEDETV
LHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSHSKELE
EPAPSTSAKAETAVKPKEAKEGDDEEIKVDVKVDEKKEDSTDEKKEEPSGAEAAVDVKPA
VEEVKEKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQECTPNIDGMKA
ESVSRERTMHSFHTLFCRRCFKYDCFLHRLQNHAGPNLQKRVFEEMKTFADPCSNSCYML
IDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSSKDFSNENTKDNGPTVNCVAEEEV
NSIMAGMMNIDSTQCVWTGADQALFRVLHKVYLRNYCAIAHNMLTKTCRQVYEFAQKDDA
EFSIDDLLLDYTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHAGPCDVNCSC
IQTQNFCEKFCNCTTECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCNACGANEFKLQ
KITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKV
YDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQ
PGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgccaaggtgccgccagagtggaagcgccgcgtcaagtcggagtactttaaa
atacggcagcaaaagcggcacaagcgcgcagacgaaataaaagaggcgtggataaagaac
tgggacgagcacaatcacaatgttcaggatctgtactgcgagtcgaaggtgtggcaggcc
aagccgtacgagcccccgcatgtgggatgcgtgaagcgggccgaaataaccagctatagc
ggcaaccccagtgggcctcagcgagtgcccatttgtgtgatcaatgccgtgactcccata
cccaccatgtatacgtgggcacccactcagcagaacttcatggtcgaggacgagacagtg
ctccacaacataccctatatgggcgatgaggtgctggacaaggatggcaagttcatcgag
gagctgataaagaactacgacggaaaagtgcatggagacaaagatccttccttcatggac
gatgccatctttgttgagctggtgcatgcgctgatgcgttcccacagcaaggagttggag
gagcctgctccaagcacttcggcaaaagcagagacagcggtgaaacccaaggaggcaaaa
gagggggacgatgaggagataaaagtggatgttaaagtggatgagaaaaaagaagactcc
actgacgagaagaaggaagagccatcgggagctgaggctgctgtggacgtaaagcccgct
gtggaggaggtgaaggaaaagcttcccttcccggctccaattatatttcaggctatcagc
gccaatttccctgacaagggcacagcacaggaactgaaggagaagtatattgagctcacc
gagcaccaggatccagagcgtccgcaggagtgcacaccgaacattgatggcatgaaggcc
gagagcgtttcccgggagcgcaccatgcactccttccacacgctcttctgccggcgctgc
ttcaaatacgattgtttcctccatcgtctgcaaaaccatgcgggtcccaatctgcagaag
cgcgtctttgaagaaatgaagacatttgctgatccgtgcagcaactcctgctatatgcta
atcgatggcatgaaggagaagctggcggctgacagcaaaacgcctcccattgactcgtgc
aatgaggccagttctgaagacagcaatgacagcaacagccagttcagcagcaaggacttc
agcaatgagaacaccaaggataatggccccaccgttaactgcgtggccgaggaagaggtt
aattccattatggctggtatgatgaacattgacagcacgcagtgcgtctggacgggggcc
gatcaagccctctttcgtgtcctgcataaagtgtatttgaggaactattgcgccattgcc
cacaatatgctcaccaagacctgtcgtcaggtgtacgagtttgcccagaaggacgacgcc
gagttcagcattgacgacttgctgctcgactatactccgccccgcaagaagaagaagaag
caacgtctgtggtcgcttcattgtcgaaagattcaactgaagaaggactcgtcatcgaat
cacgtttacaattatacgccctgcgaccacgccggtccctgcgacgtaaactgctcctgc
atacagacgcagaacttttgtgagaagttctgcaactgtaccaccgaatgccagaaccgt
ttccctggatgccgctgcaaggctcagtgcaacaccaagcagtgcccctgctatcttgct
gttcgtgagtgtgatccggatctgtgtaatgcatgcggcgctaacgaattcaagctgcag
aagattacgtgcaagaatgtgtgtgtgcagcgcggcctccacaaacacttgctgatggcc
ccatcggacattgctggttggggcatctttctgaaagagggtgcacagaagaatgaattc
atttccgagtactgcggcgagatcatctcccaagacgaggctgatcgtcgtggcaaggtc
tatgacaagtatatgtgctcttttctgttcaatttgaacaacgactttgttgtggacgcc
acacgcaagggcaacaaaatacgcttcgccaatcattccataaatcccaattgttatgcc
aaggtaatgatggtcaccggcgatcatcgcattggcatctttgccaagcgagcaattcag
cccggcgaggagctcttctttgactacagatacggacccacagagcaattgaagtttgtt
ggcatcgaacgtgaaatggaaatcgtttaa

DBGET integrated database retrieval system