KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19945Help
Entry
Dpse_GA19945      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dpse_GA19945
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dpse_GA19945
Glycosyltransferases [BR:dpo01003]
 Polysaccharide
  Storage polysaccharide
   Dpse_GA19945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 710 aa AA seqDB search
MMRRQMSYRFEDQDASPYGLRMNRRFSRVESGVDLKDYFDRGDIASRENRWNFEVAWEVA
NKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEVCARTEMEEMEFPRGNPLLDAVNSLRS
RGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGF
MIAEFLEEFRNFAVTYSQNHDLNPPRVVAHFHEWQAGVALIVLRTRQVEIATVFTTHATL
LGRYLCAGNTDFYNNMDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEH
LLKRKPDIITPNGLNVKKFSAIHEFQNMHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFI
AGRYEFGNKGADIFIEALARVNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQ
LRDTINNVQQAVGKRMFDTCVKGRLPEVGDLLEKDDMVKIKRCMYAMQRESMPPVTTHNV
ADDWNDPVLASIRRCHLFNSVNDRVKMVFHPEFLNSSNPLFGIDYEEFVRGCHLGVFPSY
YEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLEDSIQQLS
SFMMDFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKGLQAVYPDYVDELSLYG
SRSNLVFSRPHSEPPSPTSSRHTTPAPSVHGSEDEDSVDEETELKELGIK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgacgacaaatgtcctatcggtttgaagatcaagacgcctccccatatggctta
aggatgaatcgacgcttttcgagagtggagtccggcgtggacctgaaggattacttcgat
cgcggcgatattgcatcgcgcgagaaccgctggaactttgaggtggcatgggaggtggcc
aacaaggtgggcggcatttacacagtcatcaggtccaaagcctacgtatccaccgaagag
atgggcgaacagctgtgcatgatggggccctacaaggaggtctgtgcccgcaccgagatg
gaagagatggagtttccgcgtggcaatcctctgctcgatgccgtcaattcgctgcgatct
cgcggctacaagatccacaccggacgctggctggtggacggcaatccccagctaattctg
tttgacattggctctgcagcctggaagctggaccagttcaagtcggagatgtgggagaag
tgccacattggaatacctcatttggatatcgagaccaacgatgccatcatcttgggcttc
atgatcgccgagttccttgaggagttccgcaactttgctgtcacatactcacaaaaccat
gaccttaatccgccccgggttgttgcccactttcatgagtggcaggccggcgtggccctg
attgtgctgcgcacacgacaggtggaaattgccaccgtcttcaccacccatgccactctg
ctgggtcgctatttgtgtgcgggcaatacggacttttacaacaacatggataagttcgct
gtggacgaggaggcgggcaagaggcagatctaccatcgatactgcttggagcggggcgcc
acgcacctggcgcatgtgtttacaaccgtctcggaaattactggctacgaagccgagcat
ctgctcaagcgcaagccggacattatcacgcccaacggccttaacgtgaaaaagttctcg
gccattcacgagttccagaacatgcacgccgtggccaaggagaagatcaatgaattcgtg
cggggtcatttctatggccatatggactttgatttggacaagacgttgtatttcttcatc
gctggtcgctacgagttcggcaacaagggcgccgacatcttcattgaggccctggcgcgt
gtgaacgccatgctgaagcacgagcgccccgacaccacggtggtggcgttcctcattttc
cccaccaagacgaacaactttaatgtagactcgctgcgtggccatgcggtgatcaagcag
ctccgtgacaccatcaacaacgtgcagcaggcggttggtaagcgcatgttcgatacatgc
gtcaagggccgcctacccgaagtaggcgatctgctggagaaggatgatatggtgaagatc
aagcgttgcatgtacgccatgcagcgcgaatcgatgccgccggtgactacgcacaatgtg
gcagatgactggaacgatccggtgctggcgtcgattcgtcgctgtcatctcttcaattcg
gtgaacgatcgagtcaagatggtcttccatccagagttcctaaactcgtctaatcccttg
tttggcatcgactacgaggagtttgtccgcggctgccatctgggcgtcttcccctcctac
tatgagccctggggatacacacccgccgagtgcactgtcatgggaatacccagtgtgacc
acgaatctgtcgggcttcggctgtttcatgcaggagcatatcagtgatcccaagtcgtat
ggcatctacatcgtcgatcgtcgctacattggcctcgaggacagtatccagcagttgtcc
agctttatgatggacttctcgcgtctgaatcgccgccagcgtatcattcaacgcaatcgt
actgagcgtctcagcgatttgctcgactggcgtaccctgggcatttactacagacaggcc
agggtcaagggcttgcaggccgtctatccggactatgtggatgagttaagcctatacggg
tcccgcagtaacctggtcttctcgcgcccccacagtgaaccgcctagccccacctcatcg
cgtcacactaccccggccccatctgtacatggctcagaagatgaggactccgtggacgaa
gagaccgaactcaaggaattgggcatcaagtaa

DBGET integrated database retrieval system