KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28780Help
Entry
Dpse_GA28780      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dpse_GA28780
Peptidases [BR:dpo01002]
 Metallo Peptidases
  Family M2
   Dpse_GA28780
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA28780
CD molecules [BR:dpo04090]
 Proteins
  Dpse_GA28780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 846 aa AA seqDB search
MHGVLPTCSFWLCLCLGLAWASPQLNLPTPQPEISYNGYTPNVATTPAQLRADRNRDQRY
GPPYADDVGGGAADDGSDDFRYGQTYDERMRIGYAYPSPRVNFSEHPDSPFSADANQYAN
HNYGPISSTTDRNSGIDPNANGRYSDVPYSTPDNRNYNPNDQYNYNNNPNVDFVGVNNRN
RFENPFLSNQDRFNLNQGYLERQRYQQDRRYQQELEKLRTLLVESDQKGSLECTANVAAQ
WNFETNVNDFTQTEALNAQQRYVEFQRITAEQSKRINKDLIFDRRLYRQLMLQSEVGPNA
LPLDVLDRYNRLLNEMLFLYNSASVCAYQQPFQCDLHYIPHLKDIMAKSRDWDELQHTWV
EYHRKAGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYWYLAYESGNFRQDMDIVWEQIRPL
YEALHAYVRRKLRDYYGPDRINRIAPIPSHILGNMFGQSWSNVLDILIPYPGRKLIDVTP
RMVEQGYTPQLMFQLAEEFFTSINMSAVGPEFYRNSVLEQPLDRRVLCEPSAWDFCNRHD
FRVKICTDINQRSLISVHHEMAHIQYFLQYRHLPKVFRNGANPAFHQAVGDAIGLAVSTP
KHLQTLGLLQRSLDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNANKRTMNCH
YWNMREKYSGIKPPVLRSEKDFDLGAKYHIPANIPYIKYFFSTVLQFQLYRGMCREAGQY
VPGDPRKPLHKCDIYRQPAAGNMLKKLMAKGASQPWQEVLEETLQEGRLDGSALREYFAP
LEEWLRLENLRTNEYVGWNYDGDYCKRSIETAGLQVYGGFYNGANQGSALNILILMICSC
LGLRFS
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtgttttgcccacatgctctttttggctttgcctttgtcttggcctagcctgg
gccagtccacagcttaatctgccgaccccacagccggagatctcctacaatggctacacc
cccaacgtggctacgacgcccgcccagttgagggcggatcgtaatcgcgaccaacgctac
gggccgccctatgcggacgatgtcggcgggggagccgcggatgacggatccgatgacttt
aggtacggccagacctatgacgaacgcatgagaataggctatgcctatccctcgccgcgt
gtgaacttcagcgagcaccctgactcacccttcagcgcggatgccaatcagtatgccaac
cacaactacggtccgatctccagcaccaccgatcgcaactctggaattgatcccaacgcc
aacggccgatactcggatgtcccctactccactccagacaacaggaactacaaccccaac
gaccagtacaactataataacaatcccaatgtggattttgtgggggtgaacaaccggaat
cgcttcgagaaccccttcctgtccaaccaggaccgcttcaacctcaaccagggctacctg
gagcggcagcgctaccaacaggaccgtcgctaccagcaggagctggagaagctgcgcact
ctgttggtggaatccgatcagaagggctccctggagtgcacggccaacgtggcggcccag
tggaatttcgagacaaacgtaaacgattttacacagacggaagcgcttaatgctcaacaa
cgctatgtggagttccagcgaatcacggcggaacagtcgaagcgcattaacaaggacctc
atctttgatcgccgcctctacagacaactgatgttgcagtctgaagtggggcccaacgct
ctgcccttggacgttctagacaggtacaatcgcctgttgaatgaaatgcttttcctatac
aacagcgccagtgtttgcgcctaccagcagccattccagtgcgacttgcactacatacca
cacctcaaggacatcatggccaagagtagggattgggatgagctacagcacacgtgggtg
gagtatcaccgaaaagccggacgtggaatgcgcgacagctacgagcagctcattgatgta
atgcaggaggtggcctatgtgaacaatgtgaccaatggcggcgagtactggtacctggct
tacgagtcgggcaactttcgccaggatatggatattgtgtgggagcaaatccgtccgctg
tatgaggctctgcacgcctatgtgcgaaggaagcttagggattactatggaccggaccgc
attaaccgcatagcccctattccttctcacattctgggtaacatgttcggccagtcgtgg
tctaatgtcctcgacatactcattccgtatccaggtcgcaagttgattgatgtcacaccc
cgcatggttgagcagggatacactccgcagctgatgttccagctggccgaggagtttttt
acctccatcaacatgtccgccgtcggaccggagttctatcggaactcggtattggagcag
cccctggacaggagggtgctctgcgaaccctcggcctgggacttctgcaatcgtcacgat
tttcgtgtcaaaatctgcaccgacatcaatcagcggagtctgatcagcgtgcaccacgag
atggctcacattcagtacttccttcaataccgtcatctgcccaaggtcttccggaatggt
gccaatccggccttccatcaagctgtgggcgatgccatagggctggccgtgtccactcca
aagcatttgcagacattgggcctacttcaacgatcattggatgagtccagctatgacatt
aactacctctttactatggccattgacaaggtggcctttctgccctttgccttgtctttg
gataactggcgctacgacgtcttcagcggaaatgcgaacaagcgaactatgaactgccat
tactggaatatgagggaaaagtattctggtatcaagccgcctgtcctgcgatctgagaag
gacttcgatttgggtgccaagtaccatataccggcaaatattccgtacattaaatacttt
ttctcgacggtgctgcagttccagctctacaggggcatgtgccgcgaggcgggccaatat
gttcccggcgatcccaggaagccgctgcacaaatgcgacatttaccgccagccagccgct
ggcaatatgctcaaaaagctaatggccaagggcgcctcccagccatggcaagaggtactt
gaggagaccctgcaggagggccgcctggacggcagcgccttgcgggaatactttgctccg
ctcgaggaatggttgcgcctggaaaacctgcgcacgaacgaatacgttggctggaactac
gatggagactactgcaagcgaagcattgaaactgctggtcttcaggtctatggaggcttc
tacaacggggccaaccagggatcagccctaaacattctgatcctcatgatctgctcttgc
ttaggcttacgtttcagctag

DBGET integrated database retrieval system