KEGG   Drosophila sechellia: Dsec_GM17347Help
Entry
Dsec_GM17347      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM17347-PA
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
dse  Drosophila sechellia
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dsec_GM17347
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dsec_GM17347
Peptidases [BR:dse01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dsec_GM17347
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsec_GM17347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
AA seq 258 aa AA seqDB search
MAKTILQLFLYGILLVNLSLGATVRRPRLDGRIVGGQVASIKDIPYQVSLQRSYHFCGGS
LIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSL
LELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQT
QCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPG
VYSRVSAVRDWIGSVSGI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgattcttcaactgtttctctacgggattctcctggtaaatctgagcttg
ggagccactgtgaggcgccctcgcctggatggacgcatcgtgggcggccaggtggctagc
ataaaggacattccctatcaggtttccctgcagcgtagctatcacttctgtggtggctcc
ttgatcgctcagggctgggtgctcacggcggcccactgcactgaaggatcggccatactc
ttatccaaagttcgcattggctcctcgcggacttctgtgggcggtcagttggtgggcatc
aagcgagtccatcgacatcccaaattcgatgcctacaccattgactttgacttttcgctg
ctcgagctggaggaatatagtgccaagaacgtgacgcaggctttcgttgggcttcccgaa
caggatgcggacattgccgatggtactcccgtcctggtctccggctggggaaacacgcag
agcgcccaggagacctcagccgtcctgcgctccgttacggtgcccaaagtcagtcagacg
cagtgcacggaggcttatggcaactttggcagcatcacggatcgcatgctctgcgccgga
ttgccggagggcggcaaggacgcctgccaaggtgactccggaggaccactcgctgctgat
ggtgtcctctggggcgtggtctcctggggctacggctgtgccagaccaaactatcccggc
gtttactcgcgcgtgtctgcggttcgtgactggattggctctgttagtggcatttga

DBGET integrated database retrieval system