KEGG   Drosophila willistoni: Dwil_GK18967Help
Entry
Dwil_GK18967      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK18967
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK18967
   00051 Fructose and mannose metabolism
    Dwil_GK18967
   00052 Galactose metabolism
    Dwil_GK18967
   00500 Starch and sucrose metabolism
    Dwil_GK18967
   00520 Amino sugar and nucleotide sugar metabolism
    Dwil_GK18967
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dwil_GK18967
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dwil_GK18967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 460 aa AA seqDB search
MNPQAEFPEAFEICQQFTISHDQMIEVIERMTKEIKMGLARDTHPRSVVKCHISHVQDLP
TGLERGKFLALDLGGTNFRVLLVTLISDSESDMISKTYIMDKSLIIGPGSELFDFIAECL
AKFCKDHQVERDNLPLGFTFSFPLRQDGLANGVLTAWTKGFSCDGVVGKNVVQLLNEAIA
RRGDLKINIVAIINDTVGTLMSCAFSSRNCRIGLIVGTGTNASYVEKTANTEMLQNFHTS
SKQNMVINCEWGAFGDNGVLEFIKTSYDKQVDKQTPNVNKQTFEKCISGMYLGELVRLIV
VDLIYRGILFKGKSSELVFQKWSFETSFISEVESDAPGQYRNANIVLDKMGLRQATDVDK
RCLRFICQTISTRAAKLTSCGLVCLINKMNANDVTIGVDGSVYRFHPKFHDLLVHYVSKL
LRPGYHFHIVLSEDGSGRGAALVAAAAVSNKQNPSKYTYQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctcaagctgagtttccggaggcctttgagatttgccagcaatttacgattagc
catgatcaaatgattgaagtaatagaacgcatgaccaaagaaatcaaaatgggcctcgca
cgagacacgcatcccaggtctgttgtcaaatgccacattagtcacgtccaggatttgccc
acaggactagagcgtggcaagtttttagccttagatttgggaggaacaaattttcgtgtt
cttttggtcacattgattagtgattcggagtcggatatgatatcgaaaacttatataatg
gacaaatcattaatcattggcccgggctcggagctattcgattttatagccgaatgtttg
gcaaaattctgcaaggatcatcaagttgaaagagacaatttgccgttgggatttaccttt
tcgtttcctttgcgacaagatggtctggccaatggagtattgactgcctggaccaaggga
ttcagttgtgatggtgtggtgggtaagaatgtagtccaacttctgaatgaagccatcgcc
cggcgtggagatttaaaaatcaatattgttgccataatcaatgatacggttggcacttta
atgtcctgtgccttctcatcccgcaattgccgcattggtttaatcgttggcactggcacc
aatgcaagttacgtggaaaagaccgccaatacagagatgttgcagaattttcatactagc
tctaagcaaaacatggttattaattgcgagtggggagcattcggtgataatggagttctc
gaatttataaaaacctcttatgataaacaggtggacaagcaaacaccaaatgtcaacaag
cagacattcgagaaatgcatctccggcatgtatctgggagaactggtccgtctgatagtc
gtagaccttatatatagggggatactatttaaagggaagtcctcggagttagttttccag
aagtggtcgtttgagaccagcttcatctccgaggtggagagtgatgcgccggggcaatat
cgtaacgctaacatagtgcttgacaaaatgggactccgtcaggccaccgatgtcgacaaa
cgatgtttgcgtttcatttgccaaactatatcgactcgtgccgccaagctgacatcctgt
ggccttgtctgtctcatcaataagatgaacgccaatgacgtgaccatcggcgttgacggt
agtgtctataggttccatcccaaatttcacgatctgcttgtgcattatgtttctaaatta
ttaaggccaggatatcattttcatatcgtcctttcggaggatggttctggccgtggtgct
gcactagtggctgctgctgctgttagtaataaacagaatccttccaagtatacttatcaa
taa

DBGET integrated database retrieval system