KEGG   Drosophila willistoni: Dwil_GK19806Help
Entry
Dwil_GK19806      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dwi  Drosophila willistoni
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dwil_GK19806
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK19806
   00982 Drug metabolism - cytochrome P450
    Dwil_GK19806
Enzymes [BR:dwi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dwil_GK19806
Transporters [BR:dwi02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dwil_GK19806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MSTAAPGPGPAPAPSPVHYYYDLMSQPSRALFIIFRLSGMPFQDCVVALRNGEHLTDEYK
TNINRFQRVPCINDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQARVDEFLEWQHMT
LRITCALYFRTVWLEPLLTGRTPKEDKIEKLRMQMELNLDVIEDVWLQNSDFVSGSTLTA
ADIFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQTCNPHYDVAHEFVYKISGTGPQAKL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcagctcccggtccaggaccagctccggctccaagtcctgtgcattactac
tacgacttgatgtcacagccctcgagggctttgtttatcatcttccgcttaagtggcatg
ccattccaggattgtgtggtcgctttaagaaacggtgaacacttgaccgatgagtacaaa
acgaacataaatcgcttccagcgtgttccctgcatcaatgacaatggctacaagctggcc
gagagtgtggccattctaagatatttgagtgccaagggcaagatacccgagcatctgtat
cccaaatactttgtggatcaggctcgggtcgatgagttcctcgaatggcagcacatgacc
ctgagaataacctgtgccctctactttcgcactgtttggctggagcccttactgacgggt
cgcacgccgaaagaggataagattgagaagctgcgcatgcaaatggaactcaatctggat
gtcattgaggatgtgtggctacagaatagtgacttcgtgtcaggatccaccctaacagcg
gctgatatattcgctgcttgtgaaattgaacagacacgcatggccgactatgatgtccgc
atcaagtatcccaagatacgggcctggctgaaacgtgtccgccaaacgtgcaatccgcat
tatgatgttgcccacgagtttgtctacaagatctcgggaacgggaccacaagccaaactc
taa

DBGET integrated database retrieval system