KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs2666Help
Entry
ECs2666           CDS       T00048                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECs2666
Enzymes [BR:ecs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECs2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2628677..2630164
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKVQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPNEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRNYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaattggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggtgagtttgatcagaaaggcagcatccctactaaatatggcgataaa
gtacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgcgtt
aatgctgatgaccgtacgcaaattgatgaagaaatcattgaatgcgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcacagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccccaatgaagatggcatttttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggcgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggttttcgtcttgatgcggtcaaacatatt
ccagcctggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggcggagtactggtcgcatgaagttgataagctgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggacgcaactacgacatgacgcagattttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgctctaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcgcattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatttaggagagaattacggcaataaaacctggcgtgat
tttcttgggaaccggcaagagagtgtagtaaccgacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgttagcgtgtgggttatcgaagaggtgctttaa

DBGET integrated database retrieval system