KEGG   Gloeobacter violaceus: gvip042Help
Entry
gvip042           CDS       T00148                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gvi  Gloeobacter violaceus
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    gvip042 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip042 (ppc)
   00680 Methane metabolism
    gvip042 (ppc)
Enzymes [BR:gvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     gvip042 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(432198..435017)
Genome map
AA seq 939 aa AA seqDB search
MNWDTPIDLAAAGSPSALSHQSLRDNIELVEQLLRQVAAQEGGGDLVELLDRLWASHQDR
TGEGLALIRELSLEKSVLAIRAFSIYFQLINIVEQHHERKRLRLQASFSADTAQPGSFCW
LFDEMKSLGVSTPEIERVLQQLDVRLVFTAHPTEIVRRTIRTKHRRIVHLLDDLDNALSE
WQQQQVHTTMLEEIRIWWRTDELHQVRPTVLDEVAHTVHYFEEVLFEAMPRVRSELVRCL
DMFHPSLTRSLGTFCRFGSWVGSDRDGNPSVNALVTWKTACHQRSRVLAKYIKSVERLRD
LLSLAEGNPPQDLLLALEQDQRDLGEVYERYSVVYLQEPYRLKLSYILERLEHTRERNAW
LEVHGPQRLSQPDEPGWLHYYRHAHELLAELHLLRQCLRTTGIGCRPLETLIDQVEVFGF
HLAGLDVRQDSTRHEDTLTEVSAKLRLTATPYAELDEQARLEWLVRELQTLRPLIPAELP
FSARTEETIQTFRMIRRLQKEFGSEICHTYIISMSKQASDLLEVLLLAEEAGLFDPATGT
GTLMVVPLFETVEDLRNAPHVLEQLFSLPLYRCYLTCHQNLQEVMLGYSDSNKDSGFLSS
SWEIFLAQQHIQQVARRHGVQLRIFHGRGGTVGRGGGPSYQAILAQPDGTVSGRIKITEQ
GEVLASKYSLFELAAFNIETVTAAVIQASVLPTSPPGSRNWELRLQELSDVARRTYRQLV
YEQEGFIDFFCHVTPIDEISQLQISSRPSRREGRRDLASLRAIPWVFSWTQSRFLLQAWY
GLGTALDGFIRCNRERNLAELRSMYRQWPFFRTLISKVEMTLAKVDLQVAANYVQELLPK
EHEHTGECIFALIAAELERTRECVLAITEHRQLLEDNPPLQRSIALRNATIAPLGYLQAT
LLKYLRYENRQPRSYSRNELLRGALLTINGIAAGMRNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgaactgggacactccgatcgaccttgctgccgccggttctccctcggcactctcccac
cagtcgctgcgcgacaacatcgaactggtagagcaacttttgcggcaggtggctgcccaa
gaaggcgggggcgatctggtggaactgctcgatcggctgtgggcctcccaccaagatcgc
accggcgagggcctggcgctcatccgcgaactttcgctcgagaaatcggtgctcgccatc
cgggccttttcgatctatttccagctcatcaatatcgtcgagcagcaccacgagcgcaag
cggctgcggttgcaggccagtttcagcgccgataccgcccagccgggctccttttgctgg
ctgtttgacgagatgaaaagcctcggcgtctccacccccgagatcgagcgcgttctgcaa
caactcgatgtacgcctggtgtttaccgcccatcccaccgagatcgtccgccgcacgatc
cgcaccaagcaccgccggatcgtgcacctgctggatgatctcgacaacgccctcagcgaa
tggcagcagcagcaagtgcacacgaccatgctggaggaaatccgcatctggtggcgcacc
gacgagttgcaccaggtgcgcccgaccgtgctcgacgaggtggcccacacggtccattac
ttcgaggaagtgctcttcgaggcgatgccacgggtgcgcagcgaactggtccgctgcctc
gacatgttccatccctcgctcacccgttcgctgggtaccttctgccgcttcggctcctgg
gtgggctccgaccgcgacggcaatccctcggtgaacgctcttgtcacctggaagaccgcc
tgccaccagcgcagccgggtgctcgccaagtacatcaagagcgtcgagcgcctgcgcgat
ttgctcagtctcgccgagggcaacccgcctcaagatctgctgctggccctggagcaggac
cagcgcgacctgggcgaggtctacgaacgctattcggtggtctatctgcaggaaccttac
aggctgaagctgtcctacatcctcgaacggctggagcacacccgcgagcgcaacgcctgg
ctggaggtgcacggtccccagcgcctcagccagcccgacgagccggggtggctgcactat
taccgccacgcccacgaactgctggcggaactgcacctgctcaggcagtgcctgcgcacc
accggaatcggttgccggcccctggagacgctcatcgatcaagtggaggtgttcggcttt
catctggccggtctcgatgtgcgccaggacagcacccgccacgaggacaccctcacggag
gtgagcgccaagctgcgcctgacggccaccccctacgccgaactcgacgagcaggcgcgc
ctggagtggctggtgcgcgaactgcagaccctcagaccgctcatcccggcggaattgccc
ttctcggcccgcaccgaggagaccatccagacttttcggatgatccgcaggctgcaaaaa
gaattcggctccgaaatttgccacacctacatcatctcgatgagcaagcaggcaagcgat
ctcctggaggtgctcctcctcgccgaagaggcaggattgttcgatccggccaccggcacc
ggcacgctgatggtggtgccgctttttgagacggtcgaagacctgcgcaacgctccgcac
gtcctcgagcagctgttctcgctgccgctctaccgctgttaccttacctgccaccagaat
ctgcaggaggtgatgctgggctactcggactcgaacaaagattcgggcttcctctcgagc
agctgggaaatttttctggcccagcagcacatccagcaggtggcccgccgccacggtgtg
cagctgcgcatcttccacggccgcggcggtaccgtcggccgcgggggcggcccttcctac
caggctatcctcgcccagcccgacggcaccgtgagcggccgcatcaagatcaccgagcag
ggcgaagtgctcgcctcaaaatattctctcttcgaactggccgccttcaatatcgagacg
gtgaccgcggcggtcatccaggcgagcgtgctgcccaccagcccgcccggcagccgcaac
tgggaactgcggctgcaggaattgtcggatgtggcccggcgcacttaccggcaactggtc
tacgagcaagaaggtttcatcgactttttctgccacgtcacccccatcgacgaaatttcc
caactgcaaatcagctcccggccgtcccggcgcgaaggccgccgggatcttgccagtctg
cgggcgattccgtgggtgttctcctggacccagagccgctttttgctgcaggcctggtac
ggtctgggcaccgccctggacggcttcatccgctgcaaccgcgagcgcaacctggccgag
ttgcgctcgatgtaccggcagtggccgttttttcgcacgctgatttcgaaagtcgagatg
accctggccaaagtcgacctgcaagttgccgccaattacgttcaggagctgctgccaaaa
gaacacgagcacaccggcgagtgcatcttcgcgctgattgctgctgaactggagcgcacc
cgcgagtgcgtgctcgccatcaccgagcaccggcaattgctcgaagacaatccccccctg
cagcgttccattgcgcttcgcaacgccacgattgcaccgctgggttatttgcaggctacc
ttgctcaaatacctgcgctacgaaaaccgccagcctcgatcctattcgcgcaacgagctg
ttgcggggggcgctattgaccatcaacggcatcgccgccggtatgcgcaacaccggctga

DBGET integrated database retrieval system